(data stored in ACNUC9435 zone)

EMBL: CP002400.PE223

CP002400.PE223       Location/Qualifiers
FT   CDS             237034..237990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0227"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: cbe:Cbei_4345
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25814"
FT                   /db_xref="GOA:E6U6T1"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6T1"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ADU25814.1"
FT                   /translation="MKKKTIFQLNAPYREPMRVTAFLFGDADPAARETGCAVMGATRGN
FT                   EAQQIYTCAHLVERLQELEQQGGIAPGRQIAVIPTVNPYSANTAHRFWPMDDTDINRMF
FT                   PGYSLGETTQRIAWHVFEYVRPYRYGVHLSSYYMPGEFMPHVRMMQTGYEDTDAAALFG
FT                   MPYVYVRKTRPYDTTTLNYNWQIFGTHAFSLYAGKTDELDEAATARSVRAVLRFLKGMG
FT                   LLTDKVEIPSRPGHAPTQVITGENLTPVLAKTGGIMRRVRHAGDMVRRGSELGYIHDPY
FT                   DNRIRQTLLSPKDGRVFFVHRNPFVYENTTAYRILSI"
     MKKKTIFQLN APYREPMRVT AFLFGDADPA ARETGCAVMG ATRGNEAQQI YTCAHLVERL        60
     QELEQQGGIA PGRQIAVIPT VNPYSANTAH RFWPMDDTDI NRMFPGYSLG ETTQRIAWHV       120
     FEYVRPYRYG VHLSSYYMPG EFMPHVRMMQ TGYEDTDAAA LFGMPYVYVR KTRPYDTTTL       180
     NYNWQIFGTH AFSLYAGKTD ELDEAATARS VRAVLRFLKG MGLLTDKVEI PSRPGHAPTQ       240
     VITGENLTPV LAKTGGIMRR VRHAGDMVRR GSELGYIHDP YDNRIRQTLL SPKDGRVFFV       300
     HRNPFVYENT TAYRILSI                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page