(data stored in ACNUC9435 zone)

EMBL: CP002400.PE225

CP002400.PE225       Location/Qualifiers
FT   CDS             239021..241309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0229"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; KEGG: tex:Teth514_0821
FT                   ribonucleotide-diphosphate reductase subunit alpha; PFAM:
FT                   ribonucleotide reductase large subunit; Ribonucleotide
FT                   reductase large subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25816"
FT                   /db_xref="GOA:E6U6T3"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6T3"
FT                   /inference="protein motif:TFAM:TIGR02504"
FT                   /protein_id="ADU25816.1"
FT                   /translation="MDITPNARTVLEKRYLIRDADGRPTETIEELFHRVADAIAAPDRT
FT                   YNPDADIKALADRFYARMTKLEFLPNSPTLMNAGRPLGQLAACFVLPVEDSMEAIFEAI
FT                   KQAALIHKSGGGTGFSFSRLRPKGSTVNTTGGVASGPVSFMRVFNMATEAVKQGGTRRG
FT                   ANMGILRVDHPDILEFIDCKKNNADITNFNISVGITEAFMRAVEADEEYDLIDPNTKES
FT                   TGRLSAREVFEKIVDAAWRNGEPGIIFLDRLNRDNMVPSVGAIESTNPCGEQPLLPYEA
FT                   CNLGSVNLHRMLRRQEDGASVINWDKLADVVRDAVHFLDNVIDANRYPLAQIDHMTKQT
FT                   RKIGLGVMGWADLLLELGIPYNSDEAVALGEKVMGFITDTARSASAGLAQVRGAFPLFE
FT                   ESTLKNGTPVRNATMTTIAPTGTLSIIAGCSSGVEPVFAYVFIRNVMDGTELVEANPVL
FT                   RQLLEERGLYSEDLMRQIAQEGSLAHIDALPEDIRRVFVCAHDISPEYHIKMQAAFQRR
FT                   TDNAVSKTVNFAHDATIADVRRVYMLAYELGCKGVTIYRDGSRDAQVLNIGKVNAEKPA
FT                   ATEAAPSVSGTARAAGLQPRPRPNVTTGFTERCRIGCGNLYITVNYDENGICEVFTNTG
FT                   RAGGCPSQSEATARLVSIGLRAGLDVDSIIEQLKGIRCPSTIRRPGMQATSCPDAIARV
FT                   IEKVKNIQAGEPAQVSAVVVQAENEAVLHRWAPPENTPAMKYCPDCGAKMEHEGGCVIC
FT                   RNCGYSKCG"
     MDITPNARTV LEKRYLIRDA DGRPTETIEE LFHRVADAIA APDRTYNPDA DIKALADRFY        60
     ARMTKLEFLP NSPTLMNAGR PLGQLAACFV LPVEDSMEAI FEAIKQAALI HKSGGGTGFS       120
     FSRLRPKGST VNTTGGVASG PVSFMRVFNM ATEAVKQGGT RRGANMGILR VDHPDILEFI       180
     DCKKNNADIT NFNISVGITE AFMRAVEADE EYDLIDPNTK ESTGRLSARE VFEKIVDAAW       240
     RNGEPGIIFL DRLNRDNMVP SVGAIESTNP CGEQPLLPYE ACNLGSVNLH RMLRRQEDGA       300
     SVINWDKLAD VVRDAVHFLD NVIDANRYPL AQIDHMTKQT RKIGLGVMGW ADLLLELGIP       360
     YNSDEAVALG EKVMGFITDT ARSASAGLAQ VRGAFPLFEE STLKNGTPVR NATMTTIAPT       420
     GTLSIIAGCS SGVEPVFAYV FIRNVMDGTE LVEANPVLRQ LLEERGLYSE DLMRQIAQEG       480
     SLAHIDALPE DIRRVFVCAH DISPEYHIKM QAAFQRRTDN AVSKTVNFAH DATIADVRRV       540
     YMLAYELGCK GVTIYRDGSR DAQVLNIGKV NAEKPAATEA APSVSGTARA AGLQPRPRPN       600
     VTTGFTERCR IGCGNLYITV NYDENGICEV FTNTGRAGGC PSQSEATARL VSIGLRAGLD       660
     VDSIIEQLKG IRCPSTIRRP GMQATSCPDA IARVIEKVKN IQAGEPAQVS AVVVQAENEA       720
     VLHRWAPPEN TPAMKYCPDC GAKMEHEGGC VICRNCGYSK CG                          762
//

If you have problems or comments...

PBIL Back to PBIL home page