(data stored in ACNUC9435 zone)

EMBL: CP002400.PE228

CP002400.PE228       Location/Qualifiers
FT   CDS             complement(242627..243412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0232"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; KEGG: cbl:CLK_2865 putative
FT                   2-oxoacid:acceptor oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25819"
FT                   /db_xref="GOA:E6U784"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E6U784"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADU25819.1"
FT                   /translation="MAVVFQKPKGLTDTPLHYCPGCTHGIIHRLVAEAMDAFDIGGRTI
FT                   GVCPVGCAVMAYDYFSCDMVEAAHGRAPAVATGIKRALPESVVFTYQGDGDLAAIGTAE
FT                   TVHSATRGENITVIFVNNAIYGMTGGQMAPTTLPNQVTQTTPYGRDTQTAGYPVRICEM
FT                   LSTLDGAAYIERVAVDSPAHVRAAQKAIHKAFRYQIEGRGFTLVEVLSTCPTNWGLSPV
FT                   ESLDWLRENMMPYYPLGVYKDKHAETADETVKQKAEVHA"
     MAVVFQKPKG LTDTPLHYCP GCTHGIIHRL VAEAMDAFDI GGRTIGVCPV GCAVMAYDYF        60
     SCDMVEAAHG RAPAVATGIK RALPESVVFT YQGDGDLAAI GTAETVHSAT RGENITVIFV       120
     NNAIYGMTGG QMAPTTLPNQ VTQTTPYGRD TQTAGYPVRI CEMLSTLDGA AYIERVAVDS       180
     PAHVRAAQKA IHKAFRYQIE GRGFTLVEVL STCPTNWGLS PVESLDWLRE NMMPYYPLGV       240
     YKDKHAETAD ETVKQKAEVH A                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page