(data stored in ACNUC9435 zone)

EMBL: CP002400.PE230

CP002400.PE230       Location/Qualifiers
FT   CDS             complement(244486..244692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0234"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /note="KEGG: ccu:Ccur_07910 2-oxoglutarate ferredoxin
FT                   oxidoreductase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25821"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6U786"
FT                   /inference="similar to AA sequence:KEGG:Ccur_07910"
FT                   /protein_id="ADU25821.1"
FT                   /translation="MPRIIVDEERCKGCGLCATACPKGIVALSSETLNSKGYHPAHVAE
FT                   MTLCIGCAMCALMCPDVAIVVER"
     MPRIIVDEER CKGCGLCATA CPKGIVALSS ETLNSKGYHP AHVAEMTLCI GCAMCALMCP        60
     DVAIVVER                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page