(data stored in ACNUC9435 zone)

EMBL: CP002400.PE231

CP002400.PE231       Location/Qualifiers
FT   CDS             complement(244758..245420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_1707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25822"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U787"
FT                   /inference="similar to AA sequence:KEGG:Elen_1707"
FT                   /protein_id="ADU25822.1"
FT                   /translation="MLQSRLQIITGHYGSGKTTFAVNLAMENARAGRKTCLVDMDIVNP
FT                   YFRAADSKGPLEAAGVRVIRPIYAGTNLDLPALPGELAAVFDDTSYTVVLDVGGDDAGA
FT                   AALGAYAHRILAADYAHLYVFNARRPLTSTPEEAVQILREIEAVSRVPATGLVNNTNLG
FT                   NETDTDVPAASAAFAEQTAALTGLPLIYTGVRQELADAARSRLPSVYPLTMWVVPPW"
     MLQSRLQIIT GHYGSGKTTF AVNLAMENAR AGRKTCLVDM DIVNPYFRAA DSKGPLEAAG        60
     VRVIRPIYAG TNLDLPALPG ELAAVFDDTS YTVVLDVGGD DAGAAALGAY AHRILAADYA       120
     HLYVFNARRP LTSTPEEAVQ ILREIEAVSR VPATGLVNNT NLGNETDTDV PAASAAFAEQ       180
     TAALTGLPLI YTGVRQELAD AARSRLPSVY PLTMWVVPPW                             220
//

If you have problems or comments...

PBIL Back to PBIL home page