(data stored in ACNUC9435 zone)

EMBL: CP002400.PE243

CP002400.PE243       Location/Qualifiers
FT   CDS             260537..261292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0247"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; KEGG: tjr:TherJR_2127
FT                   phosphate ABC transporter, ATPase subunit; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25834"
FT                   /db_xref="GOA:E6U799"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U799"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ADU25834.1"
FT                   /translation="MNVKMAAKNVNLHYGEVHALKSVNLNAYENHVTALIGPSGCGKST
FT                   FIKTLNRMNDLIQSVRVEGEITLDGEDIYSRDMDVTLLRKRVGMVFQQPNPFPMSIYDN
FT                   IAYGPRIHGMKNHAKLDEIVEKSLRGAALWDEVHDRLKKSALGLSGGQQQRLCIARALA
FT                   VEPEVLLMDEPTSALDPISTMKIEELAGELKKQYTIIIVTHNMQQAARISDFTAFFLHG
FT                   EIVEFSETNTLFSMPKDKRTEDYITGRFG"
     MNVKMAAKNV NLHYGEVHAL KSVNLNAYEN HVTALIGPSG CGKSTFIKTL NRMNDLIQSV        60
     RVEGEITLDG EDIYSRDMDV TLLRKRVGMV FQQPNPFPMS IYDNIAYGPR IHGMKNHAKL       120
     DEIVEKSLRG AALWDEVHDR LKKSALGLSG GQQQRLCIAR ALAVEPEVLL MDEPTSALDP       180
     ISTMKIEELA GELKKQYTII IVTHNMQQAA RISDFTAFFL HGEIVEFSET NTLFSMPKDK       240
     RTEDYITGRF G                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page