(data stored in ACNUC9435 zone)

EMBL: CP002400.PE246

CP002400.PE246       Location/Qualifiers
FT   CDS             263036..264418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0250"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: pth:PTH_1830 signal transduction histidine
FT                   kinase; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25837"
FT                   /db_xref="GOA:E6U7A2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADU25837.1"
FT                   /translation="MLKRSVWGAALITVLVTVLICGLGWAAADALGQAQNRLLPPCILA
FT                   AGLLVGTLTAWVTCSRVQKRAEKCMDHITQVLGQLQQGVLDSAHVTIQDAFLPGQKRVQ
FT                   ELLMQISRESERARSERERADDMLNNMSEGLVALDNALTIVVMNKRAGEFFQSGNANML
FT                   GQNLLHLTHMPKLIEAATKTAETGKPDVFDWEDTERGLTLQISVSAVNGLDEGNRNGVV
FT                   LLISDVTAVRRTEQIRSEFVANASHELKTPLTAIKGFVELMEADIITEPDQIKSYLGRI
FT                   RKETERMIELINDILHLSELESVNADTGFTAVSMKLTAQRAAESVALSAHKRNVSVQVE
FT                   GDVGTVRANPDRMMQLALNLIDNAVKYNKPDGNVRVTIISKDGNVHFCVNDTGVGIPPE
FT                   ARQRVFERFYRVDKGRSRRQGGTGLGLSIVKHIVGLYKGRIEIESIVGEGTSITVILPA
FT                   NL"
     MLKRSVWGAA LITVLVTVLI CGLGWAAADA LGQAQNRLLP PCILAAGLLV GTLTAWVTCS        60
     RVQKRAEKCM DHITQVLGQL QQGVLDSAHV TIQDAFLPGQ KRVQELLMQI SRESERARSE       120
     RERADDMLNN MSEGLVALDN ALTIVVMNKR AGEFFQSGNA NMLGQNLLHL THMPKLIEAA       180
     TKTAETGKPD VFDWEDTERG LTLQISVSAV NGLDEGNRNG VVLLISDVTA VRRTEQIRSE       240
     FVANASHELK TPLTAIKGFV ELMEADIITE PDQIKSYLGR IRKETERMIE LINDILHLSE       300
     LESVNADTGF TAVSMKLTAQ RAAESVALSA HKRNVSVQVE GDVGTVRANP DRMMQLALNL       360
     IDNAVKYNKP DGNVRVTIIS KDGNVHFCVN DTGVGIPPEA RQRVFERFYR VDKGRSRRQG       420
     GTGLGLSIVK HIVGLYKGRI EIESIVGEGT SITVILPANL                             460
//

If you have problems or comments...

PBIL Back to PBIL home page