(data stored in ACNUC9435 zone)

EMBL: CP002400.PE248

CP002400.PE248       Location/Qualifiers
FT   CDS             complement(264956..266242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0252"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.47"
FT                   /note="TIGRFAM: O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; KEGG: cth:Cthe_1842
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25839"
FT                   /db_xref="GOA:E6U7A4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A4"
FT                   /inference="protein motif:TFAM:TIGR01326"
FT                   /protein_id="ADU25839.1"
FT                   /translation="MSERKFKFDTLQVHAGQESPDSATGARAVPVYQTTSYVFKDTDEA
FT                   EGRFALKLPGNIYSRLTNPTTDVFEQRIAALEGGTGALATASGAAAITYAILNVAGTGD
FT                   HIVSASTLYGGTYNLFATTLPRYGITTTFVDPDEPENFRKAINDKTKAVYIETLGNPGI
FT                   NVIDFDAVAAIAHEAGVPLIVDNTFATPYLFRPLEHGADVVVHSATKFIGGHGSAIGGV
FT                   IVDGGSFDWAANGKFPGFTEPDASYHGIRYVDLGGVAFVMKVRAQLLRDLGASLAPWHS
FT                   WLFIQSLETLSLRVARHVSNTEKIVKFLEEHPKVASVNYPGLPSNKYYALAQKYLPKGA
FT                   GSIFSFDVKGDERIARKFIDSLEIFSQLANVADAKSLVIHPSSTTHQQLTPEEQKAAGF
FT                   GPETVRLSIGIEDPDDLIADLDQALNKTV"
     MSERKFKFDT LQVHAGQESP DSATGARAVP VYQTTSYVFK DTDEAEGRFA LKLPGNIYSR        60
     LTNPTTDVFE QRIAALEGGT GALATASGAA AITYAILNVA GTGDHIVSAS TLYGGTYNLF       120
     ATTLPRYGIT TTFVDPDEPE NFRKAINDKT KAVYIETLGN PGINVIDFDA VAAIAHEAGV       180
     PLIVDNTFAT PYLFRPLEHG ADVVVHSATK FIGGHGSAIG GVIVDGGSFD WAANGKFPGF       240
     TEPDASYHGI RYVDLGGVAF VMKVRAQLLR DLGASLAPWH SWLFIQSLET LSLRVARHVS       300
     NTEKIVKFLE EHPKVASVNY PGLPSNKYYA LAQKYLPKGA GSIFSFDVKG DERIARKFID       360
     SLEIFSQLAN VADAKSLVIH PSSTTHQQLT PEEQKAAGFG PETVRLSIGI EDPDDLIADL       420
     DQALNKTV                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page