(data stored in ACNUC9435 zone)

EMBL: CP002400.PE251

CP002400.PE251       Location/Qualifiers
FT   CDS             268842..269027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25842"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A7"
FT                   /inference="similar to AA sequence:KEGG:Dhaf_0015"
FT                   /protein_id="ADU25842.1"
FT                   /translation="MSQLNQMELQNLRHMIGEHESAYQKLQDYAQQATDPQIKAFFQKS
FT                   AQSAQSTKQKLLSFLN"
     MSQLNQMELQ NLRHMIGEHE SAYQKLQDYA QQATDPQIKA FFQKSAQSAQ STKQKLLSFL        60
     N                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page