(data stored in ACNUC9435 zone)

EMBL: CP002400.PE256

CP002400.PE256       Location/Qualifiers
FT   CDS             complement(273224..274360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0261"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: cce:Ccel_0988 acyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25847"
FT                   /db_xref="GOA:E6U7B2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B2"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU25847.1"
FT                   /translation="MSKLFAEDKAKRKKISAFVREQIKPFAAFVDQQEAIPEQLLANIK
FT                   RSGYLGATVSPAYGGLGYSNSALFSLNEISGTGCSSFRSMLTVHGMVSIAIEKWGNDAL
FT                   KNKYLPLLASGEKLASFALSEPDAGSDLKQIKTAAVYEDGSYILNGLKKWITFGQISDL
FT                   FLVFAQVGDKPTALLVDRNTPGFSIKPIKGLLGARGSMLAELTFEQCRVPADNLVGKEG
FT                   LGLSHVAQYCLDYGRFSVASGCVGLAQACLDESIGYSKKRICSGKLLRKHPLIQKKIAE
FT                   MAVNIEAARLLCQKAAALKDAGDPQSILATWHAKYFCAKMVVQVASEAVQIHGANGCTN
FT                   EYPVERYYRDAKINEIIEGSNEIHELLIGINSYFNSRS"
     MSKLFAEDKA KRKKISAFVR EQIKPFAAFV DQQEAIPEQL LANIKRSGYL GATVSPAYGG        60
     LGYSNSALFS LNEISGTGCS SFRSMLTVHG MVSIAIEKWG NDALKNKYLP LLASGEKLAS       120
     FALSEPDAGS DLKQIKTAAV YEDGSYILNG LKKWITFGQI SDLFLVFAQV GDKPTALLVD       180
     RNTPGFSIKP IKGLLGARGS MLAELTFEQC RVPADNLVGK EGLGLSHVAQ YCLDYGRFSV       240
     ASGCVGLAQA CLDESIGYSK KRICSGKLLR KHPLIQKKIA EMAVNIEAAR LLCQKAAALK       300
     DAGDPQSILA TWHAKYFCAK MVVQVASEAV QIHGANGCTN EYPVERYYRD AKINEIIEGS       360
     NEIHELLIGI NSYFNSRS                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page