(data stored in ACNUC9435 zone)

EMBL: CP002400.PE262

CP002400.PE262       Location/Qualifiers
FT   CDS             complement(279724..291444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0267"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="KEGG: cbe:Cbei_0250 amino acid adenylation
FT                   domain-containing protein; TIGRFAM: amino acid adenylation
FT                   domain protein; SagB-type dehydrogenase domain; PFAM:
FT                   AMP-dependent synthetase and ligase; Beta-ketoacyl synthase
FT                   ; KR domain protein; phosphopantetheine-binding;
FT                   condensation domain protein; Non-ribosomal peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25853"
FT                   /db_xref="GOA:E6U7B8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B8"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ADU25853.1"
FT                   /translation="MKEIYKQIAQMIKDGKIDKGSAALLLKQLRTEEKIRSRAIAVIGM
FT                   ALHFPHADTPDAFWNVLQNGMDCITAFPKNREAQISHYVSSVFHLDEPDYQSGGFLGHI
FT                   DRFDDSFFHISPREAELMDPNQRLLLQTAVEAMEDAGYGGTQLDNTKTGVYIGYANVLK
FT                   DSYQNIIFHERPDLIPQSIINNLSAELPSRIAYLLNLKGPTMVIDTACSSSLVCIHTAC
FT                   RAILNGDCEQALAGGIKLQLVPVNHESYRVGVETESGRTRTFDDQADGACMGEGVAVVF
FT                   LKPLEKAVSDGDHVYAVVKGSAINQDGSTIGITAPNPEAQAEVLAAAWQNAGINPEALD
FT                   YIVSHGTGTRLGDPVELKGIRAAFRRYTDKKQFCAIGSVKPNVGHLFECSGVANLIAGI
FT                   LALRHQQIPPSLHFQHPNRTVGFCGGPVYVNTKLRDWNVETGEKRLCGINSFGLSGTNC
FT                   HVVLEEAPEPVAVACGATEGPRVFTLSAKSRASLSALLDSYRRFFADGTAPFDAACYTS
FT                   NVGRGHYGYRIALLADDMRDLLRKMDRISAGAPGSVPDSGLFYGYHQLVPAGVHDAGTV
FT                   TEAEIARQDELGRVLVERLAAEPGQENGAVLYRQLCELYVQGAHIDWRPLYPEDARRKI
FT                   PLPAYCFDGRPCWIPANPQAKSHSDGFFSVRWTPKPIAPTAQAGSAVLVFAREESPAAQ
FT                   QIVRDLSDAGKTVTLIVRGDGAQQAEKTSANHLFAAPGDRARYETIFRETAPSHILLLL
FT                   SPPEDDTAQAAGLSVLLSLVQAIGREAAVQLLLLGDYVYPVTGDEPYRHPQNAPLFGFL
FT                   KGVEREYRNIRCRAIDADTDFDTTRLLEEMAAPDELPVIAYRGGRRYAEQLTESAPERY
FT                   PASGMQIRDGGVYLITGGTGGIGLEMARFLAEKKRIVLILAGRTALPNRSEWDALAEHP
FT                   DTGAPGEKIRRIRALERTGAHVLTECMDVSDPAAVRACLSRVKSAFGRLDGVIHAAGIA
FT                   GNALLEDETLHNTLSVLKPKVSGAMNLLHAVQDEPLDFCLFFSSIATVLPAPGQAGYIA
FT                   ANAFLDACAGMKAGKSAVVKVINWSTWKETGMAFRHHVNMDTIFESLPTETALAYFDAV
FT                   WDRAFDRLLIGRPNPKLMFLMEKEPILLSETIDRGHVNREAAAAVQTVRPVLARANVQG
FT                   APELLGKSSDAYTPTEQKLAGYLYSTLGFDRVNVYDNFFEMGMDSISIVRLTDEIKKDF
FT                   QISLAFSVFLDNPTIYNVAKAIDVGAGVRTEKPDTVVPPSGHGDHFQAFPLSKVQASYL
FT                   FGREKKYELGGIATHAYMEIRTERDIPRLNRALRKLIERHDMLRAVILPDGTQKFLESC
FT                   PDYSIRCDDLSGLGAEEAGRHVQALRDRMSHRVYLAGEWPLFEIRACRMDHNTNLLFIS
FT                   IDMLIADAVSLEIIINELTEYYEDETLSLPQLQYSFRDYQITLARQADSPEYARDKAYW
FT                   LERLELFPDAPRLPYRTALSAISHVRFRRLEHLFSKQETDRVNELAHRHGVTLSAALCC
FT                   AYAFILSLYCNQRSLAINLATFNRKQLHPEVDQLVGDFTSVILLATELDFDRDFWANAQ
FT                   RLQSTMMEGLEHRLYEGVEFIGELAQKNGTPNAAVMPVVFTSMLYQGAGSSIGKLGQIT
FT                   YAISQTSQVVLDNQVREVDGALQFNWDYVESAFEPQEIEKIFDGYISYIQSVAAGRIDA
FT                   PVLNEDDRRLIEAYNHTEWACAPASPAELFEKQAAARPEATAVICEGERITYGDLDARS
FT                   NRLANYLKSHGVSRGNTVGILSARQIETIVNILAVLKCRAAYVPIDPGYPKSRCDYILE
FT                   NSCADLLIETDFYKEHDVGQYPADRLPEACVPDDVAYLIYTSGSTGKPKGVIISNKSAC
FT                   NTVLDMNRRFHVTERDIFLGISSLCFDLSVYDVFGALSCGGALVMVPDQHDIGHLIETV
FT                   AQQRVTIWNSVPAIMNLAVEFCENDPDARLSSLRLVLLSGDWIPLKLPDRIRRHAPDAQ
FT                   TISLGGATEGSIWSIYYPIDAVDAGWRSIPYGMPLANQTIYIVSGDGRLCPVATPGEIC
FT                   IGGIGVANGYANNEAQTTASFIAHPQLGRLYKTGDFGILTSAGYVEFLGRRDAQVKING
FT                   YRVELSEVEKCIEGLAGVEAAKAVVLQGKGGSHVIGAFVKAGRDVTAQAVQQHAAAHLP
FT                   RYMVPTTISILEAFPLTFNGKVDVKKLSATVEPEQQTVRETGASNQTEERLIRIFKETL
FT                   HLEAVGIHTSFFDMGVNSIQIIQIANKIHTVFNKKIAFKDFIDKENISELASLLQDTEQ
FT                   AAEDEVTYRSVAPDLANLNEPFPLTQVQTAYLMGREKIFELGGVSTHGYAEMENALEPD
FT                   RLNAALEKLIARHPMMRMVILENGMQQILKYVPKYRIEVVDLRGLPDEEKQQRLMDERA
FT                   RMSHYIFDPGKWPLFDLRIYRLENAKNAMFVGYDLLMADGMSIQVISRELMAYYEHPDT
FT                   DLHPIFFSFRDYVLALEDFKQNSKTYQSDRAYWLEKLEDFPFSPALPLKMPPSEVEQPH
FT                   FRRLSKVFGQRDWSRIKEFAASQSVTPSSLICSIYAKVLAFWSNSNRFALNLTVFNRYP
FT                   FHEDVNAVIGDFTSVLLLDISLNPGHTLVETAQQTQKTIMSALQHRHYEGVDFIRDIAK
FT                   RYNLERKAIMPVVFTSMIFGEMDHPEPYRSKLGKIEMSVSQTSQVYLDNQVSDSGNQLT
FT                   ITWDYVEELFDPDVVAKMFDQYTGMLTQILEGPVTGSIGVDQDAFRQILDYNQTQKPMT
FT                   ETTLAELMERQAALHAEQIAVMCEGISVSYGELSRKSNRIARYLKSKGIARGAFVGVLT
FT                   ARRIESVANILGVLKAGAAYVPINPDYPQKRREYMYDNCGCSLLLVPDTYEEEQLERLD
FT                   DSAMLDGRPEDVAYVIHTSGSTGNPKGVVISNQAACNTILDINEKFGVSGQDRILGISS
FT                   MCFDLSVYDLFGAFAAGATLVIVPDQRDIAHLLELVEREKITVWNSVPAIMELAVGQLN
FT                   RETGAEPPRMVQAAARPSAMAPRENELYYWSPAVHWTERDGHIMAGDYVCPDEMAKLMP
FT                   AFYFRAQAGATLAELAQLYGAQSDSFPHFLKELTEHRVLVNSILPPDEIFAQQNKMFVN
FT                   PYAEDIIYNYEANLRFKEEQLNRTVVRGGKPVTFPNRYQYPPSIANRRSVRDYDTERPV
FT                   PFDTLCAFLSVMHQNVEDRHYQYYYASAGGLYPIDIYLHVKPGRVENLEQGIYYYNPVA
FT                   NSLQLVEPNPTLTEAAHYYTNKKIFKSSAFSVFFLYNAGANMPKYAGKGYFYAILDAGI
FT                   LAATLTHTAELIHLGTCSIGDMMFRKVEADFHLNCNQVWVHTMEVGLKKAENGTAPEMI
FT                   ETITVNRLESGPAEQTVEQKTEETPSFRAGQWDAASLRLVLLSGDWIPLHLAGQIKTAC
FT                   PNAQIISLGGATEASIWSIYYPIRAVKTEWSSIPYGMPLANQTIYIMGLDEELCPIGTP
FT                   GEIMIGGAGVAEAYINDEQKTQAAFVVHPKLGRLYKTGDYGIFRPEGYVEFLGRKDSQI
FT                   EIGGHRIELGEITANLEQNPNTAKCVSVPYTDTNGIEQICSYVVLKNAVLISELRAYLK
FT                   ERLPDYMVPARILEVNEIPLTDNGKLNTKALPDPRLFGRETASYEGPSTEIEQKLEAIV
FT                   AQYVGTGKVSVTDDIFEAVGNSVILIQMHQEIDRMYPGIVKVVDLFNRPTIRQIAAFIQ
FT                   ETSAQRHKRRYPPICLPENWFVPKNVAKPCQADIAIRESQYAALARAARHFSTPIGTLV
FT                   FISFAYALAGMTAQETLHLPGVINRTNQMELFEIDFSGKSSFSELLEDQQAVKIVQTGP
FT                   FTNRADDWVDKGKYAIVPLVYNKSLLNSNVALSEQYDLCLAFDENSGTRELSAEIRSSR
FT                   LAPEKLRSLVGVLGKTLELLTKETAL"
     MKEIYKQIAQ MIKDGKIDKG SAALLLKQLR TEEKIRSRAI AVIGMALHFP HADTPDAFWN        60
     VLQNGMDCIT AFPKNREAQI SHYVSSVFHL DEPDYQSGGF LGHIDRFDDS FFHISPREAE       120
     LMDPNQRLLL QTAVEAMEDA GYGGTQLDNT KTGVYIGYAN VLKDSYQNII FHERPDLIPQ       180
     SIINNLSAEL PSRIAYLLNL KGPTMVIDTA CSSSLVCIHT ACRAILNGDC EQALAGGIKL       240
     QLVPVNHESY RVGVETESGR TRTFDDQADG ACMGEGVAVV FLKPLEKAVS DGDHVYAVVK       300
     GSAINQDGST IGITAPNPEA QAEVLAAAWQ NAGINPEALD YIVSHGTGTR LGDPVELKGI       360
     RAAFRRYTDK KQFCAIGSVK PNVGHLFECS GVANLIAGIL ALRHQQIPPS LHFQHPNRTV       420
     GFCGGPVYVN TKLRDWNVET GEKRLCGINS FGLSGTNCHV VLEEAPEPVA VACGATEGPR       480
     VFTLSAKSRA SLSALLDSYR RFFADGTAPF DAACYTSNVG RGHYGYRIAL LADDMRDLLR       540
     KMDRISAGAP GSVPDSGLFY GYHQLVPAGV HDAGTVTEAE IARQDELGRV LVERLAAEPG       600
     QENGAVLYRQ LCELYVQGAH IDWRPLYPED ARRKIPLPAY CFDGRPCWIP ANPQAKSHSD       660
     GFFSVRWTPK PIAPTAQAGS AVLVFAREES PAAQQIVRDL SDAGKTVTLI VRGDGAQQAE       720
     KTSANHLFAA PGDRARYETI FRETAPSHIL LLLSPPEDDT AQAAGLSVLL SLVQAIGREA       780
     AVQLLLLGDY VYPVTGDEPY RHPQNAPLFG FLKGVEREYR NIRCRAIDAD TDFDTTRLLE       840
     EMAAPDELPV IAYRGGRRYA EQLTESAPER YPASGMQIRD GGVYLITGGT GGIGLEMARF       900
     LAEKKRIVLI LAGRTALPNR SEWDALAEHP DTGAPGEKIR RIRALERTGA HVLTECMDVS       960
     DPAAVRACLS RVKSAFGRLD GVIHAAGIAG NALLEDETLH NTLSVLKPKV SGAMNLLHAV      1020
     QDEPLDFCLF FSSIATVLPA PGQAGYIAAN AFLDACAGMK AGKSAVVKVI NWSTWKETGM      1080
     AFRHHVNMDT IFESLPTETA LAYFDAVWDR AFDRLLIGRP NPKLMFLMEK EPILLSETID      1140
     RGHVNREAAA AVQTVRPVLA RANVQGAPEL LGKSSDAYTP TEQKLAGYLY STLGFDRVNV      1200
     YDNFFEMGMD SISIVRLTDE IKKDFQISLA FSVFLDNPTI YNVAKAIDVG AGVRTEKPDT      1260
     VVPPSGHGDH FQAFPLSKVQ ASYLFGREKK YELGGIATHA YMEIRTERDI PRLNRALRKL      1320
     IERHDMLRAV ILPDGTQKFL ESCPDYSIRC DDLSGLGAEE AGRHVQALRD RMSHRVYLAG      1380
     EWPLFEIRAC RMDHNTNLLF ISIDMLIADA VSLEIIINEL TEYYEDETLS LPQLQYSFRD      1440
     YQITLARQAD SPEYARDKAY WLERLELFPD APRLPYRTAL SAISHVRFRR LEHLFSKQET      1500
     DRVNELAHRH GVTLSAALCC AYAFILSLYC NQRSLAINLA TFNRKQLHPE VDQLVGDFTS      1560
     VILLATELDF DRDFWANAQR LQSTMMEGLE HRLYEGVEFI GELAQKNGTP NAAVMPVVFT      1620
     SMLYQGAGSS IGKLGQITYA ISQTSQVVLD NQVREVDGAL QFNWDYVESA FEPQEIEKIF      1680
     DGYISYIQSV AAGRIDAPVL NEDDRRLIEA YNHTEWACAP ASPAELFEKQ AAARPEATAV      1740
     ICEGERITYG DLDARSNRLA NYLKSHGVSR GNTVGILSAR QIETIVNILA VLKCRAAYVP      1800
     IDPGYPKSRC DYILENSCAD LLIETDFYKE HDVGQYPADR LPEACVPDDV AYLIYTSGST      1860
     GKPKGVIISN KSACNTVLDM NRRFHVTERD IFLGISSLCF DLSVYDVFGA LSCGGALVMV      1920
     PDQHDIGHLI ETVAQQRVTI WNSVPAIMNL AVEFCENDPD ARLSSLRLVL LSGDWIPLKL      1980
     PDRIRRHAPD AQTISLGGAT EGSIWSIYYP IDAVDAGWRS IPYGMPLANQ TIYIVSGDGR      2040
     LCPVATPGEI CIGGIGVANG YANNEAQTTA SFIAHPQLGR LYKTGDFGIL TSAGYVEFLG      2100
     RRDAQVKING YRVELSEVEK CIEGLAGVEA AKAVVLQGKG GSHVIGAFVK AGRDVTAQAV      2160
     QQHAAAHLPR YMVPTTISIL EAFPLTFNGK VDVKKLSATV EPEQQTVRET GASNQTEERL      2220
     IRIFKETLHL EAVGIHTSFF DMGVNSIQII QIANKIHTVF NKKIAFKDFI DKENISELAS      2280
     LLQDTEQAAE DEVTYRSVAP DLANLNEPFP LTQVQTAYLM GREKIFELGG VSTHGYAEME      2340
     NALEPDRLNA ALEKLIARHP MMRMVILENG MQQILKYVPK YRIEVVDLRG LPDEEKQQRL      2400
     MDERARMSHY IFDPGKWPLF DLRIYRLENA KNAMFVGYDL LMADGMSIQV ISRELMAYYE      2460
     HPDTDLHPIF FSFRDYVLAL EDFKQNSKTY QSDRAYWLEK LEDFPFSPAL PLKMPPSEVE      2520
     QPHFRRLSKV FGQRDWSRIK EFAASQSVTP SSLICSIYAK VLAFWSNSNR FALNLTVFNR      2580
     YPFHEDVNAV IGDFTSVLLL DISLNPGHTL VETAQQTQKT IMSALQHRHY EGVDFIRDIA      2640
     KRYNLERKAI MPVVFTSMIF GEMDHPEPYR SKLGKIEMSV SQTSQVYLDN QVSDSGNQLT      2700
     ITWDYVEELF DPDVVAKMFD QYTGMLTQIL EGPVTGSIGV DQDAFRQILD YNQTQKPMTE      2760
     TTLAELMERQ AALHAEQIAV MCEGISVSYG ELSRKSNRIA RYLKSKGIAR GAFVGVLTAR      2820
     RIESVANILG VLKAGAAYVP INPDYPQKRR EYMYDNCGCS LLLVPDTYEE EQLERLDDSA      2880
     MLDGRPEDVA YVIHTSGSTG NPKGVVISNQ AACNTILDIN EKFGVSGQDR ILGISSMCFD      2940
     LSVYDLFGAF AAGATLVIVP DQRDIAHLLE LVEREKITVW NSVPAIMELA VGQLNRETGA      3000
     EPPRMVQAAA RPSAMAPREN ELYYWSPAVH WTERDGHIMA GDYVCPDEMA KLMPAFYFRA      3060
     QAGATLAELA QLYGAQSDSF PHFLKELTEH RVLVNSILPP DEIFAQQNKM FVNPYAEDII      3120
     YNYEANLRFK EEQLNRTVVR GGKPVTFPNR YQYPPSIANR RSVRDYDTER PVPFDTLCAF      3180
     LSVMHQNVED RHYQYYYASA GGLYPIDIYL HVKPGRVENL EQGIYYYNPV ANSLQLVEPN      3240
     PTLTEAAHYY TNKKIFKSSA FSVFFLYNAG ANMPKYAGKG YFYAILDAGI LAATLTHTAE      3300
     LIHLGTCSIG DMMFRKVEAD FHLNCNQVWV HTMEVGLKKA ENGTAPEMIE TITVNRLESG      3360
     PAEQTVEQKT EETPSFRAGQ WDAASLRLVL LSGDWIPLHL AGQIKTACPN AQIISLGGAT      3420
     EASIWSIYYP IRAVKTEWSS IPYGMPLANQ TIYIMGLDEE LCPIGTPGEI MIGGAGVAEA      3480
     YINDEQKTQA AFVVHPKLGR LYKTGDYGIF RPEGYVEFLG RKDSQIEIGG HRIELGEITA      3540
     NLEQNPNTAK CVSVPYTDTN GIEQICSYVV LKNAVLISEL RAYLKERLPD YMVPARILEV      3600
     NEIPLTDNGK LNTKALPDPR LFGRETASYE GPSTEIEQKL EAIVAQYVGT GKVSVTDDIF      3660
     EAVGNSVILI QMHQEIDRMY PGIVKVVDLF NRPTIRQIAA FIQETSAQRH KRRYPPICLP      3720
     ENWFVPKNVA KPCQADIAIR ESQYAALARA ARHFSTPIGT LVFISFAYAL AGMTAQETLH      3780
     LPGVINRTNQ MELFEIDFSG KSSFSELLED QQAVKIVQTG PFTNRADDWV DKGKYAIVPL      3840
     VYNKSLLNSN VALSEQYDLC LAFDENSGTR ELSAEIRSSR LAPEKLRSLV GVLGKTLELL      3900
     TKETAL                                                                 3906
//

If you have problems or comments...

PBIL Back to PBIL home page