(data stored in ACNUC9435 zone)

EMBL: CP002400.PE265

CP002400.PE265       Location/Qualifiers
FT   CDS             complement(297789..299666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0270"
FT                   /product="6-deoxyerythronolide-B synthase"
FT                   /EC_number="2.3.1.94"
FT                   /note="KEGG: cce:Ccel_2377 beta-ketoacyl synthase; PFAM:
FT                   Beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25856"
FT                   /db_xref="GOA:E6U7C1"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C1"
FT                   /inference="protein motif:PRIAM:2.3.1.94"
FT                   /protein_id="ADU25856.1"
FT                   /translation="MNSLFELIDFDDIETKKPEADKSAPGENHSADEIAIIGAAVKLPR
FT                   ADNLRELWNNLLFGISACSDFPDQRYRDIENWFKCRNIRLTPQMFKKGNYLTDIDKFDY
FT                   DFFGLSADDANMMDPLHRLLLETFWNCLEDGGYCMQKVSGTCTGIYVGFNNDDIERYSR
FT                   MLQEKRVRFTMATMENNLSSILASRLSYLLNLKGPAMLIDTACSSSLCALHIACQGLKN
FT                   EDCEMALVGGINIGMVPIKYEGFRVESESDTLSPFDDSADGTVWGEGVVSLLLKPLRYA
FT                   VRDRDHVYAVIISSAINQDGMSVGISAPNAVAQRNVMVNAWEKAGINPEEISYMEAHGT
FT                   GTKLGDVIEMEGIRQAFERYTDRKQFCGIGSVKANIGHIEGASGLAGVVKLMLSLQNRV
FT                   IPKTIAFNRPNHSIAFEDSPVFLVDRLTPWESTGGRRTCGISSFGLSGTNCHAVLREFS
FT                   KDAPVSPEPAESAPYLLAVSAKSAYSFQQLLRAYAELLVENPAIDLESMCYTAGYGRDH
FT                   HRYRAAFVFTQKRELLDALKSAWNGDAARFDTNGLLRSEEKEALDREADRLVLDASQKR
FT                   GGECHQSYLDISRLYCRGAAVNWKLLYKNRAVKTLSLPVYPFERHRCWI"
     MNSLFELIDF DDIETKKPEA DKSAPGENHS ADEIAIIGAA VKLPRADNLR ELWNNLLFGI        60
     SACSDFPDQR YRDIENWFKC RNIRLTPQMF KKGNYLTDID KFDYDFFGLS ADDANMMDPL       120
     HRLLLETFWN CLEDGGYCMQ KVSGTCTGIY VGFNNDDIER YSRMLQEKRV RFTMATMENN       180
     LSSILASRLS YLLNLKGPAM LIDTACSSSL CALHIACQGL KNEDCEMALV GGINIGMVPI       240
     KYEGFRVESE SDTLSPFDDS ADGTVWGEGV VSLLLKPLRY AVRDRDHVYA VIISSAINQD       300
     GMSVGISAPN AVAQRNVMVN AWEKAGINPE EISYMEAHGT GTKLGDVIEM EGIRQAFERY       360
     TDRKQFCGIG SVKANIGHIE GASGLAGVVK LMLSLQNRVI PKTIAFNRPN HSIAFEDSPV       420
     FLVDRLTPWE STGGRRTCGI SSFGLSGTNC HAVLREFSKD APVSPEPAES APYLLAVSAK       480
     SAYSFQQLLR AYAELLVENP AIDLESMCYT AGYGRDHHRY RAAFVFTQKR ELLDALKSAW       540
     NGDAARFDTN GLLRSEEKEA LDREADRLVL DASQKRGGEC HQSYLDISRL YCRGAAVNWK       600
     LLYKNRAVKT LSLPVYPFER HRCWI                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page