(data stored in ACNUC9435 zone)

EMBL: CP002400.PE266

CP002400.PE266       Location/Qualifiers
FT   CDS             complement(299685..300524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0271"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   cce:Ccel_0974 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25857"
FT                   /db_xref="GOA:E6U7C2"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C2"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ADU25857.1"
FT                   /translation="MFGVNKKGTGTLPVGDSETQDDILKILRQFLGIPKIKATDNFFQI
FT                   GLDSMALMDVFNQLKPQIPELKLTDLFNYPSVENLSRFLDSRRSLGAEPSARAVSLPAA
FT                   FLETPGHRGWKQWSIPLDAAAYTGAQHSLGTIAVSAFGFALAKMIGAPKINLQTATSHT
FT                   NRLTEIELDFDGIASFGALHQTVAEKLSGKEEYPASALRLKCAENPPAAIFPLVYDTAL
FT                   LEIDGEQLDFFALRLGYTETGSQVTLDLEYNTNVLNSAIMEKFYLAFEKTMTKMLLH"
     MFGVNKKGTG TLPVGDSETQ DDILKILRQF LGIPKIKATD NFFQIGLDSM ALMDVFNQLK        60
     PQIPELKLTD LFNYPSVENL SRFLDSRRSL GAEPSARAVS LPAAFLETPG HRGWKQWSIP       120
     LDAAAYTGAQ HSLGTIAVSA FGFALAKMIG APKINLQTAT SHTNRLTEIE LDFDGIASFG       180
     ALHQTVAEKL SGKEEYPASA LRLKCAENPP AAIFPLVYDT ALLEIDGEQL DFFALRLGYT       240
     ETGSQVTLDL EYNTNVLNSA IMEKFYLAFE KTMTKMLLH                              279
//

If you have problems or comments...

PBIL Back to PBIL home page