(data stored in ACNUC9435 zone)

EMBL: CP002400.PE27

CP002400.PE27        Location/Qualifiers
FT   CDS             complement(29624..30268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0027"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   cbe:Cbei_1289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25618"
FT                   /db_xref="GOA:E6U5F1"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F1"
FT                   /inference="protein motif:PFAM:PF02677"
FT                   /protein_id="ADU25618.1"
FT                   /translation="MQKPNYQKQMDQTLDALARAHQTPRLLLHSCCAPCSSYVLEYLAS
FT                   HFEITVFYENPNIAPKEEYEKRLAEQKRLIAALPVPHPVGFLESHYAPERFLEAARGLE
FT                   NEPEGGARCAVCFRLRLEATARAAKAGGFDYFTTTLSVSPHKNAQALAEIGEACARRWG
FT                   VPYLAADFKKRGGYLRSIRLSETYGLYRQNFCGCVFSKRQSGTAAAPPQKA"
     MQKPNYQKQM DQTLDALARA HQTPRLLLHS CCAPCSSYVL EYLASHFEIT VFYENPNIAP        60
     KEEYEKRLAE QKRLIAALPV PHPVGFLESH YAPERFLEAA RGLENEPEGG ARCAVCFRLR       120
     LEATARAAKA GGFDYFTTTL SVSPHKNAQA LAEIGEACAR RWGVPYLAAD FKKRGGYLRS       180
     IRLSETYGLY RQNFCGCVFS KRQSGTAAAP PQKA                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page