(data stored in ACNUC9435 zone)

EMBL: CP002400.PE270

CP002400.PE270       Location/Qualifiers
FT   CDS             302979..304073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0275"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bld:BLi04003
FT                   YfiN"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25861"
FT                   /db_xref="GOA:E6U7C6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7C6"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADU25861.1"
FT                   /translation="MKRIFLVGMNMFRILFRKKSSFVLYLLLPVLIAGAAFFLTHFFST
FT                   TVTVGVVNEDDGSYGKAFVNLLGQVGNAKIVSDTPSQLRQALDTGTVDYGIAVGRDFSR
FT                   QIQSGTVPQVTFYQYGSSASSGMEELVSATLKSEVGRAAGESGESVSVKTVSVPKTTSN
FT                   GNKNISTMGLFIMFLLFSASFVSELIIEDKAGGAFYRVISTPVSEPEYVLGNILVNLVI
FT                   VSAQILIALAAILFLFHIEVYVAFWKLFLTLLLFGCTATAFGILIASFCKEHEQANSLQ
FT                   TLIILPTSMISGCLMNISIMPDAVQNAARLTPQYWTLEAITSLQKGERFLNTLPDLLIL
FT                   AGFASLFFLVAIFVFKRNRDLNAP"
     MKRIFLVGMN MFRILFRKKS SFVLYLLLPV LIAGAAFFLT HFFSTTVTVG VVNEDDGSYG        60
     KAFVNLLGQV GNAKIVSDTP SQLRQALDTG TVDYGIAVGR DFSRQIQSGT VPQVTFYQYG       120
     SSASSGMEEL VSATLKSEVG RAAGESGESV SVKTVSVPKT TSNGNKNIST MGLFIMFLLF       180
     SASFVSELII EDKAGGAFYR VISTPVSEPE YVLGNILVNL VIVSAQILIA LAAILFLFHI       240
     EVYVAFWKLF LTLLLFGCTA TAFGILIASF CKEHEQANSL QTLIILPTSM ISGCLMNISI       300
     MPDAVQNAAR LTPQYWTLEA ITSLQKGERF LNTLPDLLIL AGFASLFFLV AIFVFKRNRD       360
     LNAP                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page