(data stored in ACNUC9435 zone)

EMBL: CP002400.PE280

CP002400.PE280       Location/Qualifiers
FT   CDS             complement(314263..315309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0285"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: csc:Csac_0366 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25871"
FT                   /db_xref="GOA:E6U7D6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25871.1"
FT                   /translation="MIEVSHLTKRYGEKYAVQDISFDVKDGEILGFLGPNGAGKSTTMN
FT                   ILTGYLSSNEGTVKIDGVDVLERPLEAKKNIGYLPEQPPLYPDMTVDEYLKFVFGLKQC
FT                   KLGREAHINEICGLVRIQNVRGRLIRNLSKGFKQRVGIAQALIGNPDVLILDEPTVGLD
FT                   PKQIIEIRTLIKHLSRKHTVILSSHILPEVQSVCERIIIINQGQIVANGTTSELSSQLS
FT                   SEHRLIARIAGPEADVREAISDLSGVRKCVSLGMHETGSSDWQIECETGQDIRRALFTI
FT                   LSAKDWPLLALDTGELTLEDIFLRLTTDGAVLPQSKPAAPPAEPPAADAEPTEPAENAG
FT                   EQEEDDNP"
     MIEVSHLTKR YGEKYAVQDI SFDVKDGEIL GFLGPNGAGK STTMNILTGY LSSNEGTVKI        60
     DGVDVLERPL EAKKNIGYLP EQPPLYPDMT VDEYLKFVFG LKQCKLGREA HINEICGLVR       120
     IQNVRGRLIR NLSKGFKQRV GIAQALIGNP DVLILDEPTV GLDPKQIIEI RTLIKHLSRK       180
     HTVILSSHIL PEVQSVCERI IIINQGQIVA NGTTSELSSQ LSSEHRLIAR IAGPEADVRE       240
     AISDLSGVRK CVSLGMHETG SSDWQIECET GQDIRRALFT ILSAKDWPLL ALDTGELTLE       300
     DIFLRLTTDG AVLPQSKPAA PPAEPPAADA EPTEPAENAG EQEEDDNP                    348
//

If you have problems or comments...

PBIL Back to PBIL home page