(data stored in ACNUC9435 zone)

EMBL: CP002400.PE29

CP002400.PE29        Location/Qualifiers
FT   CDS             31311..31940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0029"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cbe:Cbei_0259
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25620"
FT                   /db_xref="GOA:E6U5F3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU25620.1"
FT                   /translation="MNNGKPVRVPRQTRSLATKGKLLAAAKELFCEVGYYKTTANAIAR
FT                   KAGTAVGSFYAYFPDKEAVFAELMERLCQRLRTVLEQCAKQLRQPDFDPKVWIAQMARQ
FT                   SVEVYVSEPKFSPQIAVLYYNREPRVTAMMQREQSFIQQMIRSYFALAGDSLSIRDPEV
FT                   SAVVVQKILIQLPEKVLYDWENIGQEEIINATIDLLQRYLTNYHKS"
     MNNGKPVRVP RQTRSLATKG KLLAAAKELF CEVGYYKTTA NAIARKAGTA VGSFYAYFPD        60
     KEAVFAELME RLCQRLRTVL EQCAKQLRQP DFDPKVWIAQ MARQSVEVYV SEPKFSPQIA       120
     VLYYNREPRV TAMMQREQSF IQQMIRSYFA LAGDSLSIRD PEVSAVVVQK ILIQLPEKVL       180
     YDWENIGQEE IINATIDLLQ RYLTNYHKS                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page