(data stored in ACNUC9435 zone)

EMBL: CP002400.PE299

CP002400.PE299       Location/Qualifiers
FT   CDS             335182..335379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25890"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7V8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU25890.1"
FT                   /translation="MRRRVCPSLGARERARKMCAYPSAPLHMPTGPETQPKQVLPKTGE
FT                   RFSAEEHPGETGLRAKLIVC"
     MRRRVCPSLG ARERARKMCA YPSAPLHMPT GPETQPKQVL PKTGERFSAE EHPGETGLRA        60
     KLIVC                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page