(data stored in ACNUC9435 zone)

EMBL: CP002400.PE302

CP002400.PE302       Location/Qualifiers
FT   CDS             337862..338119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_4270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25893"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7W1"
FT                   /inference="similar to AA sequence:KEGG:GYMC10_4270"
FT                   /protein_id="ADU25893.1"
FT                   /translation="MAENENRDEPVAESGEEKHTGTANLSVRMALGIILGAALGIAFNQ
FT                   LALGITLGLAAGILYDRYRTRKDGKPPGQGKNSGDAPKSS"
     MAENENRDEP VAESGEEKHT GTANLSVRMA LGIILGAALG IAFNQLALGI TLGLAAGILY        60
     DRYRTRKDGK PPGQGKNSGD APKSS                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page