(data stored in ACNUC9435 zone)

EMBL: CP002400.PE311

CP002400.PE311       Location/Qualifiers
FT   CDS             346410..346640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0316"
FT                   /product="acyl carrier protein"
FT                   /note="KEGG: hmo:HM1_2166 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25902"
FT                   /db_xref="GOA:E6U7X0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X0"
FT                   /inference="similar to AA sequence:KEGG:HM1_2166"
FT                   /protein_id="ADU25902.1"
FT                   /translation="MVLERVKALAAEQFDVEEDELGAETAFEELGAEPEDVADFLLALD
FT                   DEFDIDLSDIELDRIVTIGDAVDAVKDMLGQ"
     MVLERVKALA AEQFDVEEDE LGAETAFEEL GAEPEDVADF LLALDDEFDI DLSDIELDRI        60
     VTIGDAVDAV KDMLGQ                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page