(data stored in ACNUC9435 zone)

EMBL: CP002400.PE312

CP002400.PE312       Location/Qualifiers
FT   CDS             346689..347369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0317"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="SMART: ribonuclease III; double-stranded RNA binding
FT                   domain protein; TIGRFAM: ribonuclease III; KEGG:
FT                   ere:EUBREC_1500 ribonuclease III; PFAM: ribonuclease III;
FT                   double-stranded RNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25903"
FT                   /db_xref="GOA:E6U7X1"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X1"
FT                   /inference="protein motif:TFAM:TIGR02191"
FT                   /protein_id="ADU25903.1"
FT                   /translation="MLEELEKNLGYTFADKSLLENALTHSSYANEMKKHSCGSNERLEF
FT                   LGDAVLGIISAEYLYFHHTRVPEGELTRLRASMVCERSLQGFARTVELGRWLRLGRGEE
FT                   NTGGRERSSILADAFEAVIAAIYIDGGFPAAKRFVTRFADSFFAAHLENGRRDYKTELQ
FT                   EIVQKNHGEKLEYVLVGESGPDHDKQFLVEVHLNNNCIGAGRGGSKKEAEQMAAREALS
FT                   LMGQ"
     MLEELEKNLG YTFADKSLLE NALTHSSYAN EMKKHSCGSN ERLEFLGDAV LGIISAEYLY        60
     FHHTRVPEGE LTRLRASMVC ERSLQGFART VELGRWLRLG RGEENTGGRE RSSILADAFE       120
     AVIAAIYIDG GFPAAKRFVT RFADSFFAAH LENGRRDYKT ELQEIVQKNH GEKLEYVLVG       180
     ESGPDHDKQF LVEVHLNNNC IGAGRGGSKK EAEQMAAREA LSLMGQ                      226
//

If you have problems or comments...

PBIL Back to PBIL home page