(data stored in ACNUC9435 zone)

EMBL: CP002400.PE313

CP002400.PE313       Location/Qualifiers
FT   CDS             347383..348387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0318"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: gem:GM21_1061 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25904"
FT                   /db_xref="GOA:E6U7X2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU25904.1"
FT                   /translation="MGKAANVAFFVPHLGCAHACSFCDQRSIAGQAAPPSPADVAGTLA
FT                   RVREQMGSRSRDAEVAFFGGSFTAIPRRQMLALLEAVAPFLGADGFSGIRVSTRPDAVD
FT                   DDVLALLRAHGVTSIELGAQSMDDAVLCRNGRGHTARQVRDAALRVGRAGFSLGLQMMT
FT                   GLPGDGPAGARRTARELAALHPDTVRIYPALVLRGTRMAAWWADGTYEPQPLDDAVLLC
FT                   AALFDYFTRRGIRVLRMGLHAEPSLEQNLLAGPWHPAFGELCESRVYYTRARRALARAP
FT                   GADCLLAPRGETGKVAGQHRRNLLALEARVDRRLHIREDPGLPPLAVRAVKCL"
     MGKAANVAFF VPHLGCAHAC SFCDQRSIAG QAAPPSPADV AGTLARVREQ MGSRSRDAEV        60
     AFFGGSFTAI PRRQMLALLE AVAPFLGADG FSGIRVSTRP DAVDDDVLAL LRAHGVTSIE       120
     LGAQSMDDAV LCRNGRGHTA RQVRDAALRV GRAGFSLGLQ MMTGLPGDGP AGARRTAREL       180
     AALHPDTVRI YPALVLRGTR MAAWWADGTY EPQPLDDAVL LCAALFDYFT RRGIRVLRMG       240
     LHAEPSLEQN LLAGPWHPAF GELCESRVYY TRARRALARA PGADCLLAPR GETGKVAGQH       300
     RRNLLALEAR VDRRLHIRED PGLPPLAVRA VKCL                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page