(data stored in ACNUC9435 zone)

EMBL: CP002400.PE316

CP002400.PE316       Location/Qualifiers
FT   CDS             352867..353805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0321"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; KEGG: cce:Ccel_0697 signal recognition
FT                   particle-docking protein FtsY; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25907"
FT                   /db_xref="GOA:E6U7X5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X5"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ADU25907.1"
FT                   /translation="MGVFDKIRAGLAKTRASVAGRMGQVFHGRGKVDEELFEELEDVLV
FT                   SSDVGVATSTYLIEKLRGRVKKEHIVDTDGVREALKAVMTGELEGDVSLLLAPAPAVLL
FT                   VIGVNGVGKTTTIGKLAAQLKAEGKAVLLGAADTFRAAAIDQLEIWAERAGVDIVKQKE
FT                   GADPAAVVFDAVQAGKARGADVVICDTAGRLHNKKSLMDELSKISRVIDRELPGAAREN
FT                   LLVLDATTGQNAVNQAKQFKEAAGLTGIILTKLDGTARGGVVFAIRHELGVPVKYIGVG
FT                   EQIDDLQPFDPRAFVDALFQGADEEAAGQDG"
     MGVFDKIRAG LAKTRASVAG RMGQVFHGRG KVDEELFEEL EDVLVSSDVG VATSTYLIEK        60
     LRGRVKKEHI VDTDGVREAL KAVMTGELEG DVSLLLAPAP AVLLVIGVNG VGKTTTIGKL       120
     AAQLKAEGKA VLLGAADTFR AAAIDQLEIW AERAGVDIVK QKEGADPAAV VFDAVQAGKA       180
     RGADVVICDT AGRLHNKKSL MDELSKISRV IDRELPGAAR ENLLVLDATT GQNAVNQAKQ       240
     FKEAAGLTGI ILTKLDGTAR GGVVFAIRHE LGVPVKYIGV GEQIDDLQPF DPRAFVDALF       300
     QGADEEAAGQ DG                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page