(data stored in ACNUC9435 zone)

EMBL: CP002400.PE326

CP002400.PE326       Location/Qualifiers
FT   CDS             complement(362593..363351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0331"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cpy:Cphy_1026 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25917"
FT                   /db_xref="GOA:E6U7Y5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25917.1"
FT                   /translation="MSQAIVTTQKLCKTFSQSGLQQHVLKNLDLEIREGDFTVIMGASG
FT                   AGKSTLLYALSGMDRPTLGGIRFAGQDISRMNNDQLAVFRRQNCGFVFQQVFLMDSMSV
FT                   MDNVLACGLLAGGERKAVAARAKALFEQVGLREADWKKFPSQLSGGEAQRAGMVRALIN
FT                   TPKVVFADEPTGALNSASGKAVLDVLTQVHQNGQNVVMVTHDLRSARRGNRILYLKDGV
FT                   VCGECGLGSYVGGDRTRHDKLTAFLKEMGW"
     MSQAIVTTQK LCKTFSQSGL QQHVLKNLDL EIREGDFTVI MGASGAGKST LLYALSGMDR        60
     PTLGGIRFAG QDISRMNNDQ LAVFRRQNCG FVFQQVFLMD SMSVMDNVLA CGLLAGGERK       120
     AVAARAKALF EQVGLREADW KKFPSQLSGG EAQRAGMVRA LINTPKVVFA DEPTGALNSA       180
     SGKAVLDVLT QVHQNGQNVV MVTHDLRSAR RGNRILYLKD GVVCGECGLG SYVGGDRTRH       240
     DKLTAFLKEM GW                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page