(data stored in ACNUC9435 zone)

EMBL: CP002400.PE330

CP002400.PE330       Location/Qualifiers
FT   CDS             complement(367145..368482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0335"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   cce:Ccel_2204 protein of unknown function DUF111"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25921"
FT                   /db_xref="GOA:E6U7Y9"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Y9"
FT                   /inference="protein motif:PFAM:PF01969"
FT                   /protein_id="ADU25921.1"
FT                   /translation="MKTLYIDCQAGISGDMFVAALLDLGAPEQTLRDALASLHTDDFRI
FT                   EITKKQTHGILCTDYNVILTHEEPEDGSAHHHEHDHHHAGEHDHHHEHVHATAVQDTPH
FT                   SAHHAHRNLHDIEALLDASALSPAVRELSKTIFGFVARAEAKVHGLPLEEIHFHEVGAA
FT                   DSIADIVGAAVCVDALGAQDIRFSPLTEGGGFVRCAHGLLPVPAPATAEILRAARIPYR
FT                   TKDVDGEMVTPTGAAIAAGLARGFGPMPAMRVEKTGYGGGKREFPHANILRAFLGETEQ
FT                   TADPGRDRVRVLETCIDDSTGEALGHALELLFAAGAADAYYTPVFMKKNRPAWLLTVLC
FT                   APELEETMTEIIFAHTGAIGLRTRESERIVMARGFGAVDTPYGKIRLKRSTFGGVEKIK
FT                   PEFESLHAAAERAGIPITRVDTEARARAAAGEARWEPSAHSGHPFA"
     MKTLYIDCQA GISGDMFVAA LLDLGAPEQT LRDALASLHT DDFRIEITKK QTHGILCTDY        60
     NVILTHEEPE DGSAHHHEHD HHHAGEHDHH HEHVHATAVQ DTPHSAHHAH RNLHDIEALL       120
     DASALSPAVR ELSKTIFGFV ARAEAKVHGL PLEEIHFHEV GAADSIADIV GAAVCVDALG       180
     AQDIRFSPLT EGGGFVRCAH GLLPVPAPAT AEILRAARIP YRTKDVDGEM VTPTGAAIAA       240
     GLARGFGPMP AMRVEKTGYG GGKREFPHAN ILRAFLGETE QTADPGRDRV RVLETCIDDS       300
     TGEALGHALE LLFAAGAADA YYTPVFMKKN RPAWLLTVLC APELEETMTE IIFAHTGAIG       360
     LRTRESERIV MARGFGAVDT PYGKIRLKRS TFGGVEKIKP EFESLHAAAE RAGIPITRVD       420
     TEARARAAAG EARWEPSAHS GHPFA                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page