(data stored in ACNUC9435 zone)

EMBL: CP002400.PE334

CP002400.PE334       Location/Qualifiers
FT   CDS             374578..375867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0339"
FT                   /product="Uncharacterized conserved protein UCP033563"
FT                   /note="PFAM: Uncharacterised conserved protein UCP033563;
FT                   KEGG: cth:Cthe_3196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25925"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z3"
FT                   /inference="protein motif:PFAM:PF06245"
FT                   /protein_id="ADU25925.1"
FT                   /translation="MEKKLQWGAFGPADILLPRGCSMQKWSVVACDQYTSEPEYWDEVE
FT                   KFVGDAPSTLRLMFPEVYLDKEDPAARIQEIHAAMRAYLDAGRFSRLKDSFVYLERRLP
FT                   SGAVRRGLVGAVDLEQYDYSPGSASPIRPTEGTVVARIKPRMQIREGAPIELSHVMLLI
FT                   DDPDGTVIEPIARHKGALAPLYNFDLMQNGGHLSGWWLPADQAGAVRQALAALASPEAF
FT                   AKKYGLPDRPVLAYASGDGNHSLATARACYEHLKEKIGDAAKSHPARYAMVELVNIHDE
FT                   SLIFEPIHRVLTGVDAAKLRHDFITAMAADGGSLDSGDPARRVRFLHEGGDVTAYLGGD
FT                   VLPVGMVQDFLDGWMQENGGKIDYVHGDEVTARLGTQPGAASFLLPALGKSALFASVAR
FT                   DGALPRKTFSMGDANEKRFYLECRRITEDA"
     MEKKLQWGAF GPADILLPRG CSMQKWSVVA CDQYTSEPEY WDEVEKFVGD APSTLRLMFP        60
     EVYLDKEDPA ARIQEIHAAM RAYLDAGRFS RLKDSFVYLE RRLPSGAVRR GLVGAVDLEQ       120
     YDYSPGSASP IRPTEGTVVA RIKPRMQIRE GAPIELSHVM LLIDDPDGTV IEPIARHKGA       180
     LAPLYNFDLM QNGGHLSGWW LPADQAGAVR QALAALASPE AFAKKYGLPD RPVLAYASGD       240
     GNHSLATARA CYEHLKEKIG DAAKSHPARY AMVELVNIHD ESLIFEPIHR VLTGVDAAKL       300
     RHDFITAMAA DGGSLDSGDP ARRVRFLHEG GDVTAYLGGD VLPVGMVQDF LDGWMQENGG       360
     KIDYVHGDEV TARLGTQPGA ASFLLPALGK SALFASVARD GALPRKTFSM GDANEKRFYL       420
     ECRRITEDA                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page