(data stored in ACNUC9435 zone)

EMBL: CP002400.PE34

CP002400.PE34        Location/Qualifiers
FT   CDS             complement(37037..37225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: clj:CLJU_c06140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25625"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F8"
FT                   /inference="similar to AA sequence:KEGG:CLJU_c06140"
FT                   /protein_id="ADU25625.1"
FT                   /translation="MTQHSMSNVTKGIIAGVVAGAAVGMIAGWPMDRRKRNNVRKNANR
FT                   ALHAMGELVQNAQYMMR"
     MTQHSMSNVT KGIIAGVVAG AAVGMIAGWP MDRRKRNNVR KNANRALHAM GELVQNAQYM        60
     MR                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page