(data stored in ACNUC9435 zone)

EMBL: CP002400.PE346

CP002400.PE346       Location/Qualifiers
FT   CDS             383973..384509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0351"
FT                   /product="Spore cortex biosynthesis protein, YabQ-like
FT                   protein"
FT                   /note="PFAM: Spore cortex biosynthesis protein, YabQ-like;
FT                   KEGG: gtn:GTNG_0054 spore cortex biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25937"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:E6U805"
FT                   /inference="protein motif:PFAM:PF09578"
FT                   /protein_id="ADU25937.1"
FT                   /translation="MTVSVSSQMMLFLFSMGIGGAFGLVYDVLYLGRLLSPCGRVLSFL
FT                   WDCLYLLACGLFTFLFLLAGNAGEVRFFLLEGELLGFLFYRFTLGVLVSKAMRWFAART
FT                   RSAAAEAGRRLKRPVACAGRRFGLFVSQKCGQMKKRLPKDRKVVKRCLKPARKVMYNLF
FT                   HRTHYKTAGPNTPKK"
     MTVSVSSQMM LFLFSMGIGG AFGLVYDVLY LGRLLSPCGR VLSFLWDCLY LLACGLFTFL        60
     FLLAGNAGEV RFFLLEGELL GFLFYRFTLG VLVSKAMRWF AARTRSAAAE AGRRLKRPVA       120
     CAGRRFGLFV SQKCGQMKKR LPKDRKVVKR CLKPARKVMY NLFHRTHYKT AGPNTPKK         178
//

If you have problems or comments...

PBIL Back to PBIL home page