(data stored in ACNUC9435 zone)

EMBL: CP002400.PE347

CP002400.PE347       Location/Qualifiers
FT   CDS             384528..384803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0352"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   cce:Ccel_3081 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25938"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:E6U806"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADU25938.1"
FT                   /translation="MKKHKSIIFRMALGVFVLYIVVTLINQQVQIGQRKAVLAQLETQY
FT                   KQQQGQNAEIERALSENNDQYMAGVARDKLGYTKSNDRIYINVAGN"
     MKKHKSIIFR MALGVFVLYI VVTLINQQVQ IGQRKAVLAQ LETQYKQQQG QNAEIERALS        60
     ENNDQYMAGV ARDKLGYTKS NDRIYINVAG N                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page