(data stored in ACNUC9435 zone)

EMBL: CP002400.PE350

CP002400.PE350       Location/Qualifiers
FT   CDS             386719..387972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0355"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: cth:Cthe_1777
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25941"
FT                   /db_xref="GOA:E6U809"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6U809"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADU25941.1"
FT                   /translation="MVRQAHSLLVRKTCCCRAAALGGAACIHIEEKNVLIQNARIFTME
FT                   GAVIENGWLETEGGRIRALGGMETIPAAAGDVFDAKGGSLLPGLVDAHTHLGMWEDSLG
FT                   FEGDDGNEKTDPSTPHLSAVDAVNPLDRCFAEAREAGITTVVTGPGSANPVSGQLIAMK
FT                   TAGRRIDDMLLKAPVAIKFALGENPKTVYHDRDETPTTRMATAAIIREQLLKAMRYRQK
FT                   LLACRENDELEEPEFDYKCEALLPLLAREVQAHFHAHRADDIFTALRIAKEFELDAVIV
FT                   HATEGHLIAEELAAEQAKILSGPFLCDRSKPELKNQSPVSPGQMMKAGLHPAIITDHPV
FT                   VPVQYLPLCAALAVREGMEHDAALRAITIRPAEILHLENRVGSLRPGKDADLVVFDGDP
FT                   LDFYAHTVFVAVGGRRVK"
     MVRQAHSLLV RKTCCCRAAA LGGAACIHIE EKNVLIQNAR IFTMEGAVIE NGWLETEGGR        60
     IRALGGMETI PAAAGDVFDA KGGSLLPGLV DAHTHLGMWE DSLGFEGDDG NEKTDPSTPH       120
     LSAVDAVNPL DRCFAEAREA GITTVVTGPG SANPVSGQLI AMKTAGRRID DMLLKAPVAI       180
     KFALGENPKT VYHDRDETPT TRMATAAIIR EQLLKAMRYR QKLLACREND ELEEPEFDYK       240
     CEALLPLLAR EVQAHFHAHR ADDIFTALRI AKEFELDAVI VHATEGHLIA EELAAEQAKI       300
     LSGPFLCDRS KPELKNQSPV SPGQMMKAGL HPAIITDHPV VPVQYLPLCA ALAVREGMEH       360
     DAALRAITIR PAEILHLENR VGSLRPGKDA DLVVFDGDPL DFYAHTVFVA VGGRRVK          417
//

If you have problems or comments...

PBIL Back to PBIL home page