(data stored in ACNUC9435 zone)

EMBL: CP002400.PE355

CP002400.PE355       Location/Qualifiers
FT   CDS             393437..393721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0361"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: cth:Cthe_2891
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25946"
FT                   /db_xref="GOA:E6U814"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E6U814"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADU25946.1"
FT                   /translation="MALKPLADRVVIKLVEAEETTRGGIILPDNAKEKPQVAEVVAVGP
FT                   GGLVDGKEVQMYLQPGQKVIASKYAGTEVKVDGEEYTIVRQNDILAVVE"
     MALKPLADRV VIKLVEAEET TRGGIILPDN AKEKPQVAEV VAVGPGGLVD GKEVQMYLQP        60
     GQKVIASKYA GTEVKVDGEE YTIVRQNDIL AVVE                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page