(data stored in ACNUC9435 zone)

EMBL: CP002400.PE359

CP002400.PE359       Location/Qualifiers
FT   CDS             complement(397586..398059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25950"
FT                   /db_xref="UniProtKB/TrEMBL:E6U818"
FT                   /inference="similar to AA sequence:KEGG:Cbei_3647"
FT                   /protein_id="ADU25950.1"
FT                   /translation="MNPQIFIAISLFVIILMFLSVARGKVKRFNLVLIWLVPVLFLSVT
FT                   SDAFLQFPAPAPAMQVAIALATIVGGCAGFGIGLLRGKSMRFGVDARGVFYRNSYASVA
FT                   FYAAVILIKLSVQLFFVGMPFASLLSLSLLAVSCGSIFGRRIFITYKALQLAK"
     MNPQIFIAIS LFVIILMFLS VARGKVKRFN LVLIWLVPVL FLSVTSDAFL QFPAPAPAMQ        60
     VAIALATIVG GCAGFGIGLL RGKSMRFGVD ARGVFYRNSY ASVAFYAAVI LIKLSVQLFF       120
     VGMPFASLLS LSLLAVSCGS IFGRRIFITY KALQLAK                                157
//

If you have problems or comments...

PBIL Back to PBIL home page