(data stored in ACNUC9435 zone)

EMBL: CP002400.PE364

CP002400.PE364       Location/Qualifiers
FT   CDS             400621..401454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0370"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: cth:Cthe_2906 50S ribosomal protein L2;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25955"
FT                   /db_xref="GOA:E6U823"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E6U823"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADU25955.1"
FT                   /translation="MAIRKYGPTSPARRNMTVPTFEELSKVEPEKSLLVSLPKHAGRNS
FT                   YGRITVRHRGGGNRVKYRIIDFKRDKIDAPAKVLSVEYDPNRSAYIALLQYEDGEKRYI
FT                   LAPLGLKAGDTVLSGKEADIKPGNSLALSDIPVGTFVHNIELHPGKGGQLARAAGIMAQ
FT                   LMARENGMALIRLPSGELRNVPQECRATIGQVGNIDHENVKIGKAGRKRHMGWRPTVRG
FT                   SVMNPNDHPHGGGEGKSPIGRPGPVTPWGKPTLGYKTRKKKLASDKFIVKRRGGK"
     MAIRKYGPTS PARRNMTVPT FEELSKVEPE KSLLVSLPKH AGRNSYGRIT VRHRGGGNRV        60
     KYRIIDFKRD KIDAPAKVLS VEYDPNRSAY IALLQYEDGE KRYILAPLGL KAGDTVLSGK       120
     EADIKPGNSL ALSDIPVGTF VHNIELHPGK GGQLARAAGI MAQLMARENG MALIRLPSGE       180
     LRNVPQECRA TIGQVGNIDH ENVKIGKAGR KRHMGWRPTV RGSVMNPNDH PHGGGEGKSP       240
     IGRPGPVTPW GKPTLGYKTR KKKLASDKFI VKRRGGK                                277
//

If you have problems or comments...

PBIL Back to PBIL home page