(data stored in ACNUC9435 zone)

EMBL: CP002400.PE371

CP002400.PE371       Location/Qualifiers
FT   CDS             403767..404135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0377"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: cbe:Cbei_0161 50S ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25962"
FT                   /db_xref="GOA:E6U830"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E6U830"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADU25962.1"
FT                   /translation="MIQQQTYLKVADNTGAKELMCIRVLGGSRRRYANIGDIVVASVKK
FT                   ATPGGVVKKGDVVKAVIVRSVKGVGRLDGTHIRFDENAAVIIKEDKTPRGTRIFGPVAR
FT                   ELREKEYLKILSLAPEVL"
     MIQQQTYLKV ADNTGAKELM CIRVLGGSRR RYANIGDIVV ASVKKATPGG VVKKGDVVKA        60
     VIVRSVKGVG RLDGTHIRFD ENAAVIIKED KTPRGTRIFG PVARELREKE YLKILSLAPE       120
     VL                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page