(data stored in ACNUC9435 zone)

EMBL: CP002400.PE38

CP002400.PE38        Location/Qualifiers
FT   CDS             complement(40800..41912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0038"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: dat:HRM2_04090
FT                   putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25629"
FT                   /db_xref="GOA:E6U5G2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G2"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU25629.1"
FT                   /translation="MEMRTTQKTGIKTSLLGFGCMRLPQKDGAIDYAETERMLDAAYDA
FT                   GVNYFDTAYVYHGGKSEGVMGSILKKHPRASFYVADKMPVWLPKTRDDLERIFNEQLER
FT                   LGLEYIDFYLMHSMTVNNWSAVKRLDMLRFAEEKRAQGKIRYIGFSFHDTPELFREILD
FT                   AYDWDFAQIQYNYLDEKGQRAGELCDMLEQRGLFTVVMEPVRGGDLAALPEVAAGPLRQ
FT                   TTPGRSLASWALRFVGSRPGVNVILSGMSDPEQVRDNLRTCSPFDPLDERERSALAQTV
FT                   AELERIPHIACTGCRYCMPCPAGVDIPGNFDFYNGFQRFGPNPGRVRRWGMLDKKYDAC
FT                   IACGACLSKCPQHLAIPEELKRLAEVAAAL"
     MEMRTTQKTG IKTSLLGFGC MRLPQKDGAI DYAETERMLD AAYDAGVNYF DTAYVYHGGK        60
     SEGVMGSILK KHPRASFYVA DKMPVWLPKT RDDLERIFNE QLERLGLEYI DFYLMHSMTV       120
     NNWSAVKRLD MLRFAEEKRA QGKIRYIGFS FHDTPELFRE ILDAYDWDFA QIQYNYLDEK       180
     GQRAGELCDM LEQRGLFTVV MEPVRGGDLA ALPEVAAGPL RQTTPGRSLA SWALRFVGSR       240
     PGVNVILSGM SDPEQVRDNL RTCSPFDPLD ERERSALAQT VAELERIPHI ACTGCRYCMP       300
     CPAGVDIPGN FDFYNGFQRF GPNPGRVRRW GMLDKKYDAC IACGACLSKC PQHLAIPEEL       360
     KRLAEVAAAL                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page