(data stored in ACNUC9435 zone)

EMBL: CP002400.PE389

CP002400.PE389       Location/Qualifiers
FT   CDS             412036..412662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0395"
FT                   /product="ribosomal protein S4"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: ribosomal
FT                   protein S4; RNA-binding S4 domain protein; KEGG:
FT                   cce:Ccel_0786 ribosomal protein S4; SMART: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25980"
FT                   /db_xref="GOA:E6U8I9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I9"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ADU25980.1"
FT                   /translation="MARYTDSVCKLCRREGQKLFLKGERCYSDKCSVGRRSYAPGQHGQ
FT                   DRKKVSEYGIQLRAKQKARRYYGVLERQFRHYFEIAESKPGITGENLLRLLELRLDNVV
FT                   YRLGFASSHAQSRQMVRHGHFTINGKKANIPSMRVRVGDVVAVKEGSRTNEFIKSVVEA
FT                   NASRPIPKWLEINREALSGTVAVLPNREDIDLSVEEHLIVELYSK"
     MARYTDSVCK LCRREGQKLF LKGERCYSDK CSVGRRSYAP GQHGQDRKKV SEYGIQLRAK        60
     QKARRYYGVL ERQFRHYFEI AESKPGITGE NLLRLLELRL DNVVYRLGFA SSHAQSRQMV       120
     RHGHFTINGK KANIPSMRVR VGDVVAVKEG SRTNEFIKSV VEANASRPIP KWLEINREAL       180
     SGTVAVLPNR EDIDLSVEEH LIVELYSK                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page