(data stored in ACNUC9435 zone)

EMBL: CP002400.PE391

CP002400.PE391       Location/Qualifiers
FT   CDS             413775..414116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0397"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: cac:CA_C3103 50S ribosomal protein L17;
FT                   TIGRFAM: ribosomal protein L17; PFAM: ribosomal protein
FT                   L17"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25982"
FT                   /db_xref="GOA:E6U8J1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J1"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADU25982.1"
FT                   /translation="MPGTRKLGRSTDHRLAMLRAMVTFLLENGKIETTLARAKEVRSLA
FT                   EKMITLGKETDLHSKRQIYSFITKEAVSKKVIDELGPKYKEVSGGYTRIYKIGPRRGDA
FT                   AEMAIIELI"
     MPGTRKLGRS TDHRLAMLRA MVTFLLENGK IETTLARAKE VRSLAEKMIT LGKETDLHSK        60
     RQIYSFITKE AVSKKVIDEL GPKYKEVSGG YTRIYKIGPR RGDAAEMAII ELI              113
//

If you have problems or comments...

PBIL Back to PBIL home page