(data stored in ACNUC9435 zone)

EMBL: CP002400.PE392

CP002400.PE392       Location/Qualifiers
FT   CDS             414275..414421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0398"
FT                   /product="RNA-binding region RNP-1"
FT                   /note="KEGG: sye:Syncc9902_0300 RNA-binding region RNP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25983"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J2"
FT                   /inference="similar to AA sequence:KEGG:Syncc9902_0300"
FT                   /protein_id="ADU25983.1"
FT                   /translation="MPDKFERKQNGGTRQKGHTPAPAGDQIGENAEEGRWAKEEGKKQD
FT                   RRS"
     MPDKFERKQN GGTRQKGHTP APAGDQIGEN AEEGRWAKEE GKKQDRRS                     48
//

If you have problems or comments...

PBIL Back to PBIL home page