(data stored in ACNUC9435 zone)

EMBL: CP002400.PE395

CP002400.PE395       Location/Qualifiers
FT   CDS             415851..417170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0401"
FT                   /product="glutamine synthetase, type I"
FT                   /note="KEGG: eel:EUBELI_00431 glutamine synthetase;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25986"
FT                   /db_xref="GOA:E6U8J5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J5"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADU25986.1"
FT                   /translation="MDREDVFQFMEENDVKFIRFQFTDISGIMKNIAINYSNLESALDG
FT                   VLFDGYAVDGFSRSEESEMLLVPELDTLNIFPWRPQQGKVVRFICDVLSQDGTPFAGDP
FT                   RYILKKMVAKAAAKGYMFLVEPECEFFLFHTDEHGLPTTQTHDTAGYFDLAPIDLGENA
FT                   RREVCLSLENMGFLVESSHHEVAAGQHEIDFRYDDALKTADNIETFRMVVKIIAQKHGL
FT                   HATFMPKPLHNEAGSGMHINMSLVRGEQDVLADPNDELGLSKEGYYFIGGIMKHIRGLT
FT                   ALCNPLVNSYKRLVPGTEAPAYILWARKNRGPLIRVPYFKDGRARVELLSPDPACNPYL
FT                   SLAALLGAGMEGIEKQITPPPEMKANIQDMSPRAIREAGIERLPATLGEALDALEQDAL
FT                   LREILGEHAFRSYLSTKRAEWDSYCETVHPWETGRYLSIY"
     MDREDVFQFM EENDVKFIRF QFTDISGIMK NIAINYSNLE SALDGVLFDG YAVDGFSRSE        60
     ESEMLLVPEL DTLNIFPWRP QQGKVVRFIC DVLSQDGTPF AGDPRYILKK MVAKAAAKGY       120
     MFLVEPECEF FLFHTDEHGL PTTQTHDTAG YFDLAPIDLG ENARREVCLS LENMGFLVES       180
     SHHEVAAGQH EIDFRYDDAL KTADNIETFR MVVKIIAQKH GLHATFMPKP LHNEAGSGMH       240
     INMSLVRGEQ DVLADPNDEL GLSKEGYYFI GGIMKHIRGL TALCNPLVNS YKRLVPGTEA       300
     PAYILWARKN RGPLIRVPYF KDGRARVELL SPDPACNPYL SLAALLGAGM EGIEKQITPP       360
     PEMKANIQDM SPRAIREAGI ERLPATLGEA LDALEQDALL REILGEHAFR SYLSTKRAEW       420
     DSYCETVHPW ETGRYLSIY                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page