(data stored in ACNUC9435 zone)

EMBL: CP002400.PE396

CP002400.PE396       Location/Qualifiers
FT   CDS             417234..417779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0402"
FT                   /product="ANTAR domain protein"
FT                   /note="PFAM: ANTAR domain protein; KEGG: dhd:Dhaf_0995
FT                   response regulator receiver and ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25987"
FT                   /db_xref="GOA:E6U8J6"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J6"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADU25987.1"
FT                   /translation="MSDGMLVVCGQRAFCKNLCDLIASSIAIHPIVATSGAEARRKTSM
FT                   HEMEAVLLAGKLPDENTLDLALELSQSGVAGVMIVIDRGTLFEAHEVLDGSGVTILANP
FT                   LTKDALIQAIRLVMKVAEGGGTLDRAKLMLVQQKGWTEPQAHRYIQKLSMDKRLPRELA
FT                   AQLVIKALEREQQAKEES"
     MSDGMLVVCG QRAFCKNLCD LIASSIAIHP IVATSGAEAR RKTSMHEMEA VLLAGKLPDE        60
     NTLDLALELS QSGVAGVMIV IDRGTLFEAH EVLDGSGVTI LANPLTKDAL IQAIRLVMKV       120
     AEGGGTLDRA KLMLVQQKGW TEPQAHRYIQ KLSMDKRLPR ELAAQLVIKA LEREQQAKEE       180
     S                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page