(data stored in ACNUC9435 zone)

EMBL: CP002400.PE399

CP002400.PE399       Location/Qualifiers
FT   CDS             421264..422007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0405"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: cbb:CLD_3005 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25990"
FT                   /db_xref="GOA:E6U8J9"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J9"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADU25990.1"
FT                   /translation="MRRFGIIFRIDLFNVFKNPVLVGYNTLFTVALVFTLGYLNGGAYA
FT                   DGWTAYRYYLVSFLVYSVLTGSMTASNAFMERDIKKPNLRILFSPAGSFPIYFSKILAS
FT                   ALFDYICHGTLAVALGALFHFPNFGQFWLLLLVLIPLELASAALGTFFCCVLHSEESTS
FT                   SLLSTVIGVLAFLGGTFFSLDSMGGVVALISRCSPVKWINDALFALLIDGNAAVAAPLF
FT                   FGALAAAAALTAGCVRFFHTEDYVC"
     MRRFGIIFRI DLFNVFKNPV LVGYNTLFTV ALVFTLGYLN GGAYADGWTA YRYYLVSFLV        60
     YSVLTGSMTA SNAFMERDIK KPNLRILFSP AGSFPIYFSK ILASALFDYI CHGTLAVALG       120
     ALFHFPNFGQ FWLLLLVLIP LELASAALGT FFCCVLHSEE STSSLLSTVI GVLAFLGGTF       180
     FSLDSMGGVV ALISRCSPVK WINDALFALL IDGNAAVAAP LFFGALAAAA ALTAGCVRFF       240
     HTEDYVC                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page