(data stored in ACNUC9435 zone)

EMBL: CP002400.PE402

CP002400.PE402       Location/Qualifiers
FT   CDS             complement(425682..426740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0408"
FT                   /product="lipase class 3"
FT                   /note="PFAM: lipase class 3; KEGG: cbe:Cbei_1776
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25993"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K2"
FT                   /inference="protein motif:PFAM:PF01764"
FT                   /protein_id="ADU25993.1"
FT                   /translation="MDGLQNDLTEQDFSFLAQLVYFDPLRADGTPWPSRGQAHVTCSVG
FT                   DLLASYRRLLGTPNDPLRPPKLTGVHAWVYDDQVHFLTDPNNDAYAGWIVTGICAHNTP
FT                   VESGLYGFTVHIDDHTSAVVFRGSENPKDHLNDWHASLDISNNLLIDQHREALAYIDER
FT                   ADLFGQPGHTLYFVGHSLGGHVAQICTFLSPEPVRANIRQCVTFNSPGFSLAFLEKYAE
FT                   TVAAEKRKILNYQNENDFVSSLLTSPVTPVILRSRYDQLNFFCNHAISSCRLDQNGRFI
FT                   PARVQKKSFVCGGVYNWSLGIQKWSHERQERNKWFWVSLFQGDPLYVKAYSSQLLLLFK
FT                   NGMRAITASMSL"
     MDGLQNDLTE QDFSFLAQLV YFDPLRADGT PWPSRGQAHV TCSVGDLLAS YRRLLGTPND        60
     PLRPPKLTGV HAWVYDDQVH FLTDPNNDAY AGWIVTGICA HNTPVESGLY GFTVHIDDHT       120
     SAVVFRGSEN PKDHLNDWHA SLDISNNLLI DQHREALAYI DERADLFGQP GHTLYFVGHS       180
     LGGHVAQICT FLSPEPVRAN IRQCVTFNSP GFSLAFLEKY AETVAAEKRK ILNYQNENDF       240
     VSSLLTSPVT PVILRSRYDQ LNFFCNHAIS SCRLDQNGRF IPARVQKKSF VCGGVYNWSL       300
     GIQKWSHERQ ERNKWFWVSL FQGDPLYVKA YSSQLLLLFK NGMRAITASM SL               352
//

If you have problems or comments...

PBIL Back to PBIL home page