(data stored in ACNUC9435 zone)

EMBL: CP002400.PE407

CP002400.PE407       Location/Qualifiers
FT   CDS             complement(433038..434417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0413"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: mla:Mlab_0177 hypothetical protein; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25998"
FT                   /db_xref="GOA:E6U8K7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8K7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU25998.1"
FT                   /translation="MDIKKQAMSLLVTEAVKYLEHEPEKHFDRLISIAKVLVKGRDPFY
FT                   QNIIKQFDDMWHDESSPWRGYLINYLTKLNPNQRKKFATNFLVNASIIGFTEQQKMAEK
FT                   LDCNIPWTILMDPTSACNLKCTGCWAAEYAKQNNLTFEELDNVIEQGKKLSIYFYVFSG
FT                   GEPLVRKKDILRLCEKHSDCFFAAFTNGTLIDEEFASEMERLGNFVPIISIEGFEEATD
FT                   MRRGKGVYQSVIRAMDILHARNLAFGMSVCYHSKNTDYVGSDEFVDFMIEKGVLFGWYF
FT                   TYMPVGADAHKELLATPEQRAHMYKRVNEIRATKPIFVLDFWNDGAYVDGCIAAGRRYF
FT                   HINSAGDAEPCAFIHYSNYNIREKSVMEILKSPLFMAYHKGQPFNKNMLRPCPLLDNPE
FT                   ALAGMVKATGAHSTEALSPEDVDVLTSKTKEQAELWAETADDLWKVDPKNKENVRDRVN
FT                   A"
     MDIKKQAMSL LVTEAVKYLE HEPEKHFDRL ISIAKVLVKG RDPFYQNIIK QFDDMWHDES        60
     SPWRGYLINY LTKLNPNQRK KFATNFLVNA SIIGFTEQQK MAEKLDCNIP WTILMDPTSA       120
     CNLKCTGCWA AEYAKQNNLT FEELDNVIEQ GKKLSIYFYV FSGGEPLVRK KDILRLCEKH       180
     SDCFFAAFTN GTLIDEEFAS EMERLGNFVP IISIEGFEEA TDMRRGKGVY QSVIRAMDIL       240
     HARNLAFGMS VCYHSKNTDY VGSDEFVDFM IEKGVLFGWY FTYMPVGADA HKELLATPEQ       300
     RAHMYKRVNE IRATKPIFVL DFWNDGAYVD GCIAAGRRYF HINSAGDAEP CAFIHYSNYN       360
     IREKSVMEIL KSPLFMAYHK GQPFNKNMLR PCPLLDNPEA LAGMVKATGA HSTEALSPED       420
     VDVLTSKTKE QAELWAETAD DLWKVDPKNK ENVRDRVNA                              459
//

If you have problems or comments...

PBIL Back to PBIL home page