(data stored in ACNUC9435 zone)

EMBL: CP002400.PE41

CP002400.PE41        Location/Qualifiers
FT   CDS             44817..47363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0041"
FT                   /product="peptidase C1A papain"
FT                   /note="KEGG: mac:MA1513 hypothetical protein; PFAM:
FT                   peptidase C1A papain; SMART: peptidase C1A papain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25632"
FT                   /db_xref="GOA:E6U5G5"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR040528"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G5"
FT                   /inference="protein motif:PFAM:PF00112"
FT                   /protein_id="ADU25632.1"
FT                   /translation="MKNRLVKVVGVVCAVGFFAVFDCGLALEAAASAVSTASLSSVAIQ
FT                   EDGPQSVSGGSYAASRYTVPHAGASAVRLYGASNIPSSYDLRAQNKVTSVKNQGSEGDC
FT                   WAYAAMGSLESTLKPAEDDTFSESALESNSGFDLGVNAGGNDQMSTAYLARWSGPVNQS
FT                   GTSGVQKHVQNVDWLPGRSGYGDTTADNAIKQELLAGTAVTASLYYGSGYYTSGTSSYY
FT                   YNGSSVPNHEIDVVGWDDNYPAANFAGSSAGTPAHNGAFLCQNSWGTGWGANGYFYVSY
FT                   DDTAFGRDGCAAFNDAESTGNYSEVYQYDPLGFTASTPGSSGVQWMANVFKAEDSNSLT
FT                   AVSFYTLSPSMGYQIYVIPQYTSSLSSDTRTLVASGTESSAGYHTVSFSSSVALTQGSS
FT                   FAVEVRFTTSGASIPLEMPISGYSSKATASSGQSYISYDGNGWADTTQAFGLSNINVCL
FT                   KAFTKAPASGSSSSGSSSSGSSSSSGSSGSSSLGGASSLGSSVKPNPSLPAKIAVDSPS
FT                   DSMQYGNVTVSGWALSGWGITRIDMYLDLGTPWQKGGYSTKAVNSRPDVQAVMDPQNQY
FT                   PNSATSGYSLTIPAGDLTVGRHTVYVAAIANDGSVDWAVRGFWVGPSAAGNLDSPADTV
FT                   NCGDVTVSGWALNHAGMNRVDVYVDLGTAQQKFYSTLVNIPRPDVKTIIDPYGHYIGST
FT                   TSGYSLTIPAEDLTAGRHTVNVAAIGNDGTVQWFVRGFTVGPDAAGNLDSPSNSMQYGN
FT                   VTVSGWALNHAGIQRVDVYVDLYTAQQQFYSTSAHLSRPDVRAVVDPCGRYIGSTNSGF
FT                   SLTIPASALTAGRHTVNVAAIGNDGTVQWFVGSFNH"
     MKNRLVKVVG VVCAVGFFAV FDCGLALEAA ASAVSTASLS SVAIQEDGPQ SVSGGSYAAS        60
     RYTVPHAGAS AVRLYGASNI PSSYDLRAQN KVTSVKNQGS EGDCWAYAAM GSLESTLKPA       120
     EDDTFSESAL ESNSGFDLGV NAGGNDQMST AYLARWSGPV NQSGTSGVQK HVQNVDWLPG       180
     RSGYGDTTAD NAIKQELLAG TAVTASLYYG SGYYTSGTSS YYYNGSSVPN HEIDVVGWDD       240
     NYPAANFAGS SAGTPAHNGA FLCQNSWGTG WGANGYFYVS YDDTAFGRDG CAAFNDAEST       300
     GNYSEVYQYD PLGFTASTPG SSGVQWMANV FKAEDSNSLT AVSFYTLSPS MGYQIYVIPQ       360
     YTSSLSSDTR TLVASGTESS AGYHTVSFSS SVALTQGSSF AVEVRFTTSG ASIPLEMPIS       420
     GYSSKATASS GQSYISYDGN GWADTTQAFG LSNINVCLKA FTKAPASGSS SSGSSSSGSS       480
     SSSGSSGSSS LGGASSLGSS VKPNPSLPAK IAVDSPSDSM QYGNVTVSGW ALSGWGITRI       540
     DMYLDLGTPW QKGGYSTKAV NSRPDVQAVM DPQNQYPNSA TSGYSLTIPA GDLTVGRHTV       600
     YVAAIANDGS VDWAVRGFWV GPSAAGNLDS PADTVNCGDV TVSGWALNHA GMNRVDVYVD       660
     LGTAQQKFYS TLVNIPRPDV KTIIDPYGHY IGSTTSGYSL TIPAEDLTAG RHTVNVAAIG       720
     NDGTVQWFVR GFTVGPDAAG NLDSPSNSMQ YGNVTVSGWA LNHAGIQRVD VYVDLYTAQQ       780
     QFYSTSAHLS RPDVRAVVDP CGRYIGSTNS GFSLTIPASA LTAGRHTVNV AAIGNDGTVQ       840
     WFVGSFNH                                                                848
//

If you have problems or comments...

PBIL Back to PBIL home page