(data stored in ACNUC9435 zone)

EMBL: CP002400.PE419

CP002400.PE419       Location/Qualifiers
FT   CDS             complement(449580..450251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0425"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   clj:CLJU_c25150 acyl carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26010"
FT                   /db_xref="GOA:E6U8L9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8L9"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ADU26010.1"
FT                   /translation="MKKLLYISASPKPETESVSKQAARTFIQRLMAQETDYQLEELDLY
FT                   TSDIPMPGHQHFDRQSHLVAGPAYEALSPEDKAVIDRMNQLCTQFQQADTYVISAPMWG
FT                   MSFPSRLKQYFDCILLIDHLFSIDSTGFHGLLGDKERRMVYVQSSGGVYPKIFYGQMNY
FT                   AVKYCHDIFKHLGVATFDPILVQGAETPGVGRYKALEVAAQDMDDVLCRLAGPHPMPRW
FT                   A"
     MKKLLYISAS PKPETESVSK QAARTFIQRL MAQETDYQLE ELDLYTSDIP MPGHQHFDRQ        60
     SHLVAGPAYE ALSPEDKAVI DRMNQLCTQF QQADTYVISA PMWGMSFPSR LKQYFDCILL       120
     IDHLFSIDST GFHGLLGDKE RRMVYVQSSG GVYPKIFYGQ MNYAVKYCHD IFKHLGVATF       180
     DPILVQGAET PGVGRYKALE VAAQDMDDVL CRLAGPHPMP RWA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page