(data stored in ACNUC9435 zone)

EMBL: CP002400.PE424

CP002400.PE424       Location/Qualifiers
FT   CDS             468409..469155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0430"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: cth:Cthe_1855
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26015"
FT                   /db_xref="GOA:E6U8M4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU26015.1"
FT                   /translation="MSAYDVLGRYYDLLMQDMDYEARADYLLSVLERHGEKPGTVLDLA
FT                   CGTGSLSVELARHGREVVGVDASEQMLAQAAEKAAAFPQGQMLFLLQKMGEIDLYGTVS
FT                   AAVCTLDGINHLLTEHDVRRAFERVALFLEPGGLFVFDVNTPYKFRHVLDGNAFVYDYD
FT                   EIYCVWQNAFDGESGICEFLLTFFEQEKGRYRRQDEAFAERAYGDAELRGWLRDAGLAP
FT                   LARYADLSFDAPGETEERVVYVARKE"
     MSAYDVLGRY YDLLMQDMDY EARADYLLSV LERHGEKPGT VLDLACGTGS LSVELARHGR        60
     EVVGVDASEQ MLAQAAEKAA AFPQGQMLFL LQKMGEIDLY GTVSAAVCTL DGINHLLTEH       120
     DVRRAFERVA LFLEPGGLFV FDVNTPYKFR HVLDGNAFVY DYDEIYCVWQ NAFDGESGIC       180
     EFLLTFFEQE KGRYRRQDEA FAERAYGDAE LRGWLRDAGL APLARYADLS FDAPGETEER       240
     VVYVARKE                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page