(data stored in ACNUC9435 zone)

EMBL: CP002400.PE429

CP002400.PE429       Location/Qualifiers
FT   CDS             complement(472878..474380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0435"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="TIGRFAM: threonine synthase; KEGG: cth:Cthe_1381
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26020"
FT                   /db_xref="GOA:E6U8M9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8M9"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADU26020.1"
FT                   /translation="MMNYKSTRNNDVTVTASVAISRGISEDGGLFVPESMPWLSYTDLK
FT                   ILTDSDYVARANDILSRFLGDFTPGEVLNCVSQAYTREKFETESIAPLYELEPGVYLLE
FT                   LWHGPTCAFKDMALQLLPHLLSVSVEKAEPGKTVVILVATSGDTGKAALEGFRDVPGTR
FT                   ILVFYPEQGVSPLQKLQMATQEGENVYVSAIRGNFDDAQAGVKAVFTDTAVKQKLAEHN
FT                   MVFSSANSINWGRLVPQIVYYISSYCDLIKNNRISAGEHINIVVPTGNFGNILAAYYAK
FT                   KMGIPINKLICASNANNVLTEFLQTGVYDRNRPFYTTISPSMDILISSNLERLLYDLSA
FT                   CDDKQVRGYMDSLAKTGRYEVDEAIKKSLQEHFWASYCDDDGTRSTIRETYAKNACVTD
FT                   PHTAVALNVYRQYREKTGDEAKTIIASTASAYKFAGDVVGAIRSEQTANADQRTLVGEL
FT                   SKLSLSKPPKQISSLFEKPVRFEGVCDKEGMQQTIFTVLGID"
     MMNYKSTRNN DVTVTASVAI SRGISEDGGL FVPESMPWLS YTDLKILTDS DYVARANDIL        60
     SRFLGDFTPG EVLNCVSQAY TREKFETESI APLYELEPGV YLLELWHGPT CAFKDMALQL       120
     LPHLLSVSVE KAEPGKTVVI LVATSGDTGK AALEGFRDVP GTRILVFYPE QGVSPLQKLQ       180
     MATQEGENVY VSAIRGNFDD AQAGVKAVFT DTAVKQKLAE HNMVFSSANS INWGRLVPQI       240
     VYYISSYCDL IKNNRISAGE HINIVVPTGN FGNILAAYYA KKMGIPINKL ICASNANNVL       300
     TEFLQTGVYD RNRPFYTTIS PSMDILISSN LERLLYDLSA CDDKQVRGYM DSLAKTGRYE       360
     VDEAIKKSLQ EHFWASYCDD DGTRSTIRET YAKNACVTDP HTAVALNVYR QYREKTGDEA       420
     KTIIASTASA YKFAGDVVGA IRSEQTANAD QRTLVGELSK LSLSKPPKQI SSLFEKPVRF       480
     EGVCDKEGMQ QTIFTVLGID                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page