(data stored in ACNUC9435 zone)

EMBL: CP002400.PE441

CP002400.PE441       Location/Qualifiers
FT   CDS             484149..485405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0447"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="KEGG: drm:Dred_3162 serine hydroxymethyltransferase;
FT                   PFAM: glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26032"
FT                   /db_xref="GOA:E6U8P1"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8P1"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADU26032.1"
FT                   /translation="MYADMLDTIGFVKQYDPEVGGAMEGELKRQRRNIELIASENIVSP
FT                   AVLAAMGTVLTNKYAEGYPGKRYYGGCANVDEVETIAIERAKKLFGAEHANVQPHSGAQ
FT                   ANSAVYFGLLKPGDTVMGMSLAEGGHLTHGSPVNISGSYYHFIPYGVDAETGLIDYDAM
FT                   RKLAIENKPKMIVAGASAYPRVIDFKRIGEIAKEAGALLMVDMAHIAGLVAAGLHPSPV
FT                   PYADIVTTTTHKTLRGPRGGLILCREEYAKAIDKAIFPGTQGGPLEHIIAAKAVCLGEA
FT                   LHDDFKAYQTQIVKNAAAMAKGLLSRGHRLVTGGTDNHLMLLDLRGTGVTGKELQRRLD
FT                   DVYITANKNAIPNDPEKPFVTSGVRLGTPAVTTRGMVEADMDKIAEFISIAASDRFEKE
FT                   VEELRADVNALCAKYPLYE"
     MYADMLDTIG FVKQYDPEVG GAMEGELKRQ RRNIELIASE NIVSPAVLAA MGTVLTNKYA        60
     EGYPGKRYYG GCANVDEVET IAIERAKKLF GAEHANVQPH SGAQANSAVY FGLLKPGDTV       120
     MGMSLAEGGH LTHGSPVNIS GSYYHFIPYG VDAETGLIDY DAMRKLAIEN KPKMIVAGAS       180
     AYPRVIDFKR IGEIAKEAGA LLMVDMAHIA GLVAAGLHPS PVPYADIVTT TTHKTLRGPR       240
     GGLILCREEY AKAIDKAIFP GTQGGPLEHI IAAKAVCLGE ALHDDFKAYQ TQIVKNAAAM       300
     AKGLLSRGHR LVTGGTDNHL MLLDLRGTGV TGKELQRRLD DVYITANKNA IPNDPEKPFV       360
     TSGVRLGTPA VTTRGMVEAD MDKIAEFISI AASDRFEKEV EELRADVNAL CAKYPLYE         418
//

If you have problems or comments...

PBIL Back to PBIL home page