(data stored in ACNUC9435 zone)

EMBL: CP002400.PE443

CP002400.PE443       Location/Qualifiers
FT   CDS             complement(486739..487014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: der:Dere_GG13352 GG13352 gene product from
FT                   transcript GG13352-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26034"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8P3"
FT                   /inference="similar to AA sequence:KEGG:Dere_GG13352"
FT                   /protein_id="ADU26034.1"
FT                   /translation="MQATKIRMKPGRSSSDELTEIDSIYLTGCQQVGYYKKEDIHNYLI
FT                   GRPGNIQVNIYPYPNIVPATSSRGEKYVRSTPDSSLKDNLLNLPRT"
     MQATKIRMKP GRSSSDELTE IDSIYLTGCQ QVGYYKKEDI HNYLIGRPGN IQVNIYPYPN        60
     IVPATSSRGE KYVRSTPDSS LKDNLLNLPR T                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page