(data stored in ACNUC9435 zone)

EMBL: CP002400.PE445

CP002400.PE445       Location/Qualifiers
FT   CDS             488311..489105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spv:SPH_0462 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26036"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X2"
FT                   /inference="similar to AA sequence:KEGG:SPH_0462"
FT                   /protein_id="ADU26036.1"
FT                   /translation="METFDYVFVVLVYRNPHDLRGFLASLARVEGSRKVIVVNSFYDQP
FT                   TRDETAAVCEEHGCDFLNVENRGYGAGNNAGIRFARAHYRFAFLVISNPDIEIQALPAT
FT                   VLEQKGRTVLLGPLVRTENGKRQNPYMPAHSALRERLMCFYTRHSRSMAPFWAAVALNK
FT                   THRILFNVLFGRRERRVYALHGSFLLFSEPALQKLGLPFDERMFLFREEDHLARRARGL
FT                   GIPMRYTPGIRVLHHEDGSVRFLSAQTRRYALDSLRIYFGLQ"
     METFDYVFVV LVYRNPHDLR GFLASLARVE GSRKVIVVNS FYDQPTRDET AAVCEEHGCD        60
     FLNVENRGYG AGNNAGIRFA RAHYRFAFLV ISNPDIEIQA LPATVLEQKG RTVLLGPLVR       120
     TENGKRQNPY MPAHSALRER LMCFYTRHSR SMAPFWAAVA LNKTHRILFN VLFGRRERRV       180
     YALHGSFLLF SEPALQKLGL PFDERMFLFR EEDHLARRAR GLGIPMRYTP GIRVLHHEDG       240
     SVRFLSAQTR RYALDSLRIY FGLQ                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page